Python bivittatus (Burmese python): 103053577 Help Entry 103053577         CDS       T03091                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism pbi  Python bivittatus (Burmese python) Pathway pbi04137   Mitophagy - animal pbi04140   Autophagy - animal pbi04144   Endocytosis pbi04145   Phagosome pbi04148   Efferocytosis pbi05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pbi00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103053577 (RAB7A)    04145 Phagosome     103053577 (RAB7A)    04140 Autophagy - animal     103053577 (RAB7A)    04137 Mitophagy - animal     103053577 (RAB7A)    04148 Efferocytosis     103053577 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103053577 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pbi04131]     103053577 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pbi04147]     103053577 (RAB7A)    04031 GTP-binding proteins [BR:pbi04031]     103053577 (RAB7A) Membrane trafficking [BR:pbi04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     103053577 (RAB7A) Exosome [BR:pbi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103053577 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    103053577 (RAB7A)   Exosomal proteins of colorectal cancer cells    103053577 (RAB7A)   Exosomal proteins of bladder cancer cells    103053577 (RAB7A) GTP-binding proteins [BR:pbi04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     103053577 (RAB7A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_7 NTPase_1 AAA_24 AAA_22 AAA_16 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 ATP-synt_ab FLYWCH_N Motif Other DBs NCBI-GeneID:  103053577 NCBI-ProteinID:  XP_007421960 UniProt:  A0A9F5J269 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKASAENCTC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacttctagaaagaaagtattactcaaagtcatcattcttggagattcaggggtggga aagacatctcttatgaatcagtatgtgaacaaaaaattcagtaaccagtacaaagctaca ataggggcagacttcctgaccaaggaggtgatggtggatgatagattagtcacaatgcag atatgggatacagcagggcaggagcggtttcagtctttgggagttgccttctacagggga gcagactgctgtgtgctggtgtttgatgtaacagctcccaacacgtttaaaactcttgat agctggcgagacgagttcctcattcaagccagtccccgagatcctgagaactttcctttt gttgtgctgggaaacaagattgacctagaaaatagacaagttaccacaaaacgagcacag gcctggtgctacagcaaaaacaatattccttactttgaaaccagtgcgaaggaggctatt aacgtggaacaagctttccagacaattgcacgaaatgcacttaaacaggaaactgaagtg gagctttacaatgaatttccggaacctatcaagctagacaagaatgaccgagcaaaggct tctgcagagaattgcacctgctga

DBGET integrated database retrieval system