Python bivittatus (Burmese python): 103056613 Help Entry 103056613         CDS       T03091                                  Name (RefSeq) heat shock protein beta-1   KO K04455   heat shock protein beta-1 Organism pbi  Python bivittatus (Burmese python) Pathway pbi04010   MAPK signaling pathway pbi04370   VEGF signaling pathway Brite KEGG Orthology (KO) [BR:pbi00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103056613    04370 VEGF signaling pathway     103056613  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:pbi03041]     103056613    03110 Chaperones and folding catalysts [BR:pbi03110]     103056613   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pbi04147]     103056613 Spliceosome [BR:pbi03041]  Complex B   U4/U6.U5 tri-snRNP components    U4/U6.U5 tri-snRNP related factors     103056613  Complex C    U4/U6.U5 tri-SnRNP related factors     103056613 Chaperones and folding catalysts [BR:pbi03110]  Heat shock proteins   HSP20    103056613 Exosome [BR:pbi04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    103056613   Exosomal proteins of breast cancer cells    103056613   Exosomal proteins of bladder cancer cells    103056613 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HSP20 Motif Other DBs NCBI-GeneID:  103056613 NCBI-ProteinID:  XP_007425984 UniProt:  A0A9F2KV65 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search KSTDRSITEVFSFPGKHEERQDEHGFISRCFTRKYTLPPGIDAAVVRSSLSPDGMLTVEA PLPKPAIQSAEITIPVTFEAHAQIPPSDVKKPEEATKK NT seq 297 nt NT seq  +upstreamnt  +downstreamnt aaaagcactgatcgttccatcacagaggtattttcttttccaggcaaacatgaagaaaga caagatgaacacgggttcatttccagatgtttcacaaggaaatacacgctgcctcctggc attgatgcagccgtggtccgatcgtcactttccccagatggcatgctgacagtggaagca cccttgcccaaaccagccattcagtctgcagagatcacaatcccagtcactttcgaagcc catgcccagatccctccatcggatgtcaagaagcctgaggaggccaccaagaaataa

DBGET integrated database retrieval system