Puma concolor (puma): 112853159 Help Entry 112853159         CDS       T08890                                  Name (RefSeq) C-C motif chemokine 3   KO K05408   C-C motif chemokine 3 Organism pcoo  Puma concolor (puma) Pathway pcoo04060   Cytokine-cytokine receptor interaction pcoo04061   Viral protein interaction with cytokine and cytokine receptor pcoo04062   Chemokine signaling pathway pcoo04620   Toll-like receptor signaling pathway pcoo05142   Chagas disease pcoo05163   Human cytomegalovirus infection pcoo05323   Rheumatoid arthritis pcoo05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pcoo00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112853159    04061 Viral protein interaction with cytokine and cytokine receptor     112853159  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112853159    04062 Chemokine signaling pathway     112853159  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     112853159   09174 Infectious disease: parasitic    05142 Chagas disease     112853159   09163 Immune disease    05323 Rheumatoid arthritis     112853159   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112853159  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcoo04052]     112853159    00536 Glycosaminoglycan binding proteins [BR:pcoo00536]     112853159 Cytokines and neuropeptides [BR:pcoo04052]  Cytokines   Chemokines    112853159 Glycosaminoglycan binding proteins [BR:pcoo00536]  Heparan sulfate / Heparin   Chemokines    112853159 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  112853159 NCBI-ProteinID:  XP_025772471 UniProt:  A0A6P6HB15 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MKVPGAALAILLCTMALCRQVFSAPFGADTPTACCFSYVSKQIPRKFIADYFETSSQCSK PGVIFQTRRGRQVCADPSEAWVQEYVTDLELSA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaggtccccggggctgccctcgccatcctcctctgcaccatggccctctgccgtcag gtcttctctgcaccatttggtgctgacaccccaactgcctgctgcttctcctatgtctcc aagcagattccacgcaagttcatagccgactattttgagaccagcagccaatgctccaag ccaggggttatctttcaaaccagaagaggccggcaggtctgtgctgaccccagtgaagcc tgggtccaggaatatgtgactgacttggagctgagtgcctga

DBGET integrated database retrieval system