Puma concolor (puma): 112868759 Help Entry 112868759         CDS       T08890                                  Name (RefSeq) histone H2B type 2-F   KO K11252   histone H2B Organism pcoo  Puma concolor (puma) Pathway pcoo04613   Neutrophil extracellular trap formation pcoo05034   Alcoholism pcoo05203   Viral carcinogenesis pcoo05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pcoo00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     112868759  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     112868759   09163 Immune disease    05322 Systemic lupus erythematosus     112868759   09165 Substance dependence    05034 Alcoholism     112868759  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pcoo03036]     112868759   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcoo04147]     112868759 Chromosome and associated proteins [BR:pcoo03036]  Eukaryotic type   Nucleosome assembly factors    Histones     112868759 Exosome [BR:pcoo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112868759 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF6246 Motif Other DBs NCBI-GeneID:  112868759 NCBI-ProteinID:  XP_025787489 UniProt:  A0A6P6II69 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgatccagcgaagtcggctcccgctcccaagaagggctctaagaaagctgttacg aaagtgcagaagaaggacggcaagaagcgcaagcgtagccgtaaggagagctattccgtc tatgtgtataaggtgttgaaacaggttcacccggacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgccggtgaagcctctcgc ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacagccgtgcgt ctgctgctgcccggcgaactggccaagcacgccgtgtccgagggcaccaaggctgtcacc aaatacaccagctcgaagtaa

DBGET integrated database retrieval system