Phascolarctos cinereus (koala): 110214887 Help Entry 110214887         CDS       T05867                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism pcw  Phascolarctos cinereus (koala) Pathway pcw04146   Peroxisome pcw04213   Longevity regulating pathway - multiple species pcw05012   Parkinson disease pcw05014   Amyotrophic lateral sclerosis pcw05016   Huntington disease pcw05020   Prion disease pcw05022   Pathways of neurodegeneration - multiple diseases pcw05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:pcw00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     110214887 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     110214887 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     110214887 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     110214887 (SOD1)    05014 Amyotrophic lateral sclerosis     110214887 (SOD1)    05016 Huntington disease     110214887 (SOD1)    05020 Prion disease     110214887 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     110214887 (SOD1) Enzymes [BR:pcw01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      110214887 (SOD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  110214887 NCBI-ProteinID:  XP_020851652 UniProt:  A0A6P5L1Q7 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MLKAVCVLKGDGPVQGTIYFEQKQAGEPVEIKGSITGLAEGNHGFHVHEFGDNTQGCTSA GAHFNPHSKKHGGPNDDERHVGDLGNVTADKDGVAKVSIKDHLIQLSGPMSIIGRTMVVH EKADDLGKGGNSESEKTGNAGPRLACGIIGIAK NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgctgaaggcggtgtgcgttctgaagggcgacggccccgtgcaaggcacgatctacttc gagcagaagcaggctggggagcctgtggaaatcaagggaagcattacaggattagctgag ggaaatcatggattccacgtccatgaatttggcgataacactcaaggatgtacaagtgca ggtgctcactttaatcctcattccaaaaaacatggtggaccaaatgatgatgaaaggcat gttggagaccttggcaatgtgactgctgacaaagatggtgtggcaaaagtgtctatcaaa gatcatctaattcaactttcaggaccaatgtctatcattggccgtactatggtggtccac gagaaagctgatgacttgggcaaagggggaaattcagagagtgaaaagacgggaaatgct ggacctcgcctagcttgtggcataattgggattgctaagtaa

DBGET integrated database retrieval system