Phoenix dactylifera (date palm): 103696640 Help Entry 103696640         CDS       T03274                                  Name (RefSeq) cathepsin B-like protease 1   KO K01363   cathepsin B [EC:3.4.22.1] Organism pda  Phoenix dactylifera (date palm) Brite KEGG Orthology (KO) [BR:pda00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:pda01002]     103696640   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pda03110]     103696640   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pda04147]     103696640    00536 Glycosaminoglycan binding proteins [BR:pda00536]     103696640 Enzymes [BR:pda01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.22  Cysteine endopeptidases     3.4.22.1  cathepsin B      103696640 Peptidases and inhibitors [BR:pda01002]  Cysteine peptidases   Family C1: papain family    103696640 Chaperones and folding catalysts [BR:pda03110]  Intramolecular chaperones   Papain family    103696640 Exosome [BR:pda04147]  Exosomal proteins   Exosomal proteins of microglial cells    103696640 Glycosaminoglycan binding proteins [BR:pda00536]  Heparan sulfate / Heparin   Others    103696640 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Peptidase_C1 Motif Other DBs NCBI-GeneID:  103696640 NCBI-ProteinID:  XP_038979357 UniProt:  A0A8B9A142 LinkDB All DBs Position Unknown AA seq 77 aa AA seqDB search MGGHAVKLIGWGTSDDGEDYWLLANQWNSGWGDDGYFKIVRSRNECGIEEDVVAGLPSSK NLFRNYAGSDIIGDAAI NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgggtggccatgccgtgaagttaataggatgggggactagtgatgatggtgaagattat tggcttcttgcaaatcagtggaatagtggctggggtgatgatggttacttcaaaatcgta aggagcaggaacgaatgtggaattgaggaggacgtagttgctggtttgccttcatccaaa aacttattccgaaactatgctggcagtgatataattggtgatgctgctatctga

DBGET integrated database retrieval system