Phalaenopsis equestris: 110039241 Help Entry 110039241         CDS       T05601                                  Name (RefSeq) elongin-C-like   KO K03872   elongin-C Organism peq  Phalaenopsis equestris Pathway peq04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:peq00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     110039241  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:peq04121]     110039241    03400 DNA repair and recombination proteins [BR:peq03400]     110039241 Ubiquitin system [BR:peq04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      110039241    Cul5 complex      110039241 DNA repair and recombination proteins [BR:peq03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      110039241 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  110039241 NCBI-ProteinID:  XP_020599898 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MKKEETVKLISAEGFEFVVDKKAAMVSHTIRNMLTSPGSFAETQHGEVTFPEISTPILEK ICQYFYWSLQFARYLFIIFLFFIIFFLNCNFIYLKIN NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaagaaggaggagacggtgaagctcatcagcgccgagggcttcgagtttgttgtcgac aagaaagctgccatggtctcccacacgatccgcaatatgctcacttctccaggtagtttc gcggagacgcagcacggcgaggttactttcccagagattagtactccaattctggagaag atctgccaatatttctattggtcgcttcaatttgccaggtacctgttcatcatcttctta tttttcataattttctttctgaactgcaatttcatataccttaaaattaactag

DBGET integrated database retrieval system