Populus euphratica (Euphrates poplar): 105141209 Help Entry 105141209         CDS       T05872                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism peu  Populus euphratica (Euphrates poplar) Pathway peu03083   Polycomb repressive complex peu04120   Ubiquitin mediated proteolysis peu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:peu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     105141209    04120 Ubiquitin mediated proteolysis     105141209   09126 Chromosome    03083 Polycomb repressive complex     105141209  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:peu04131]     105141209    04121 Ubiquitin system [BR:peu04121]     105141209    03036 Chromosome and associated proteins [BR:peu03036]     105141209 Membrane trafficking [BR:peu04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     105141209 Ubiquitin system [BR:peu04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    SCF complex     Adaptor protein      105141209    Cul7 complex      105141209 Chromosome and associated proteins [BR:peu03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      105141209   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      105141209 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ BTB Motif Other DBs NCBI-GeneID:  105141209 NCBI-ProteinID:  XP_011046673 LinkDB All DBs Position Unknown AA seq 161 aa AA seqDB search MSESKKITLKSSDGETFVVDEAVAVESQTIKHMIEDDCADNEIPLPNVTSKILAKVIEYC KKHVEAGSDKEKNVTGVTEKDESLKSWDTEFVKVDQNTLFDLILAANYLNIKDLLDLTCQ TVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 486 nt NT seq  +upstreamnt  +downstreamnt atgtcagaatcaaagaaaatcactctcaaatcatctgatggcgagacattcgtcgtcgat gaagcggtcgctgtggagtcacaaaccatcaaacacatgattgaagatgactgcgccgat aacgagatcccgttgccaaacgtgacaagcaagattcttgctaaggttatcgagtactgc aagaaacatgtggaagctggttctgataaggagaagaatgttacaggtgttactgagaag gatgagtctttgaagagttgggacaccgagtttgtcaaggttgatcaaaataccctcttt gacctcatcctggcagctaactacctgaacatcaaggacttgctagatttgacctgccag actgtggctgacatgatcaaggggaagactccagaagagattcgcaagacatttaacatc aagaatgacttcactccagaggaagaggaggaggtgcgcagggagaaccagtgggcattt gagtga

DBGET integrated database retrieval system