Poecilia formosa (Amazon molly): 103151925 Help Entry 103151925         CDS       T07984                                  Symbol tmsb4x Name (RefSeq) thymosin beta-4   KO K05764   thymosin, beta 4 Organism pfor  Poecilia formosa (Amazon molly) Pathway pfor04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:pfor00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     103151925 (tmsb4x)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pfor04812]     103151925 (tmsb4x) Cytoskeleton proteins [BR:pfor04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Thymosin      103151925 (tmsb4x) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thymosin Motif Other DBs NCBI-GeneID:  103151925 NCBI-ProteinID:  XP_007572270 LinkDB All DBs Position Unknown AA seq 42 aa AA seqDB search MSDKPDISEVTSFDKSKLKKTETQEKNPLPTKETIEQEKQAS NT seq 129 nt NT seq  +upstreamnt  +downstreamnt atgagtgacaagcccgacatctccgaggtgaccagcttcgacaagtccaagctgaagaag acagagacgcaggagaagaaccccctgcctacaaaagagaccattgaacaggagaagcaa gcatcatga

DBGET integrated database retrieval system