Pteropus giganteus (Indian flying fox): 120598834 Help Entry 120598834         CDS       T07511                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism pgig  Pteropus giganteus (Indian flying fox) Pathway pgig04146   Peroxisome pgig04213   Longevity regulating pathway - multiple species pgig05012   Parkinson disease pgig05014   Amyotrophic lateral sclerosis pgig05016   Huntington disease pgig05020   Prion disease pgig05022   Pathways of neurodegeneration - multiple diseases pgig05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:pgig00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     120598834 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     120598834 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     120598834 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     120598834 (SOD1)    05014 Amyotrophic lateral sclerosis     120598834 (SOD1)    05016 Huntington disease     120598834 (SOD1)    05020 Prion disease     120598834 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     120598834 (SOD1) Enzymes [BR:pgig01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      120598834 (SOD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  120598834 NCBI-ProteinID:  XP_039713841 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MTTKAVCVLKGDGKVQGTIHFEQKRNGLVVVSGTITGLTEGDHGFHVHQFGDNTQGCTSA GPHFNPLGKTHGGPKDEERHVGDLGNVTAGKDGMAHVHIEDSMIALSGDHSIIGRTMVVH EKPDDLGKGENDESKKTGNAGSRLACGVIGIAQ NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgacgaccaaggccgtgtgtgtgttgaagggcgatgggaaggtgcagggcaccatccac ttcgagcagaagagaaatgggctggtcgtggtctcgggaaccatcacaggattgactgaa ggtgaccatgggttccacgtccatcagttcggggataatacacaaggctgtaccagtgca ggtcctcacttcaatccacttggcaaaacacatggtgggccaaaggatgaagagaggcat gttggcgacctgggcaacgtgactgccggcaaagatgggatggctcacgtgcacatcgaa gactctatgattgccctctcgggagaccattccatcattggccgcactatggtggtccat gaaaaaccagatgacttgggcaaaggtgaaaatgatgaaagtaaaaagacgggaaatgct ggaagtcgtttggcttgtggtgtcattgggatcgcccagtaa

DBGET integrated database retrieval system