Pyricularia grisea: PgNI_12512 Help Entry PgNI_12512        CDS       T09406                                  Name (RefSeq) uncharacterized protein   KO K03094   S-phase kinase-associated protein 1 Organism pgri  Pyricularia grisea Pathway pgri03083   Polycomb repressive complex pgri04111   Cell cycle - yeast pgri04120   Ubiquitin mediated proteolysis pgri04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pgri00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     PgNI_12512    04120 Ubiquitin mediated proteolysis     PgNI_12512   09126 Chromosome    03083 Polycomb repressive complex     PgNI_12512  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     PgNI_12512  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pgri04131]     PgNI_12512    04121 Ubiquitin system [BR:pgri04121]     PgNI_12512    03036 Chromosome and associated proteins [BR:pgri03036]     PgNI_12512 Membrane trafficking [BR:pgri04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     PgNI_12512 Ubiquitin system [BR:pgri04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    SCF complex     Adaptor protein      PgNI_12512    Cul7 complex      PgNI_12512 Chromosome and associated proteins [BR:pgri03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      PgNI_12512   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      PgNI_12512 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 VGCC_beta4Aa_N Motif Other DBs NCBI-GeneID:  41967363 NCBI-ProteinID:  XP_030976032 UniProt:  A0A6P8AM97 LinkDB All DBs Position Unknown AA seq 167 aa AA seqDB search MAEGQLQKVKLQSNGGQTIEVDRAIACRSRLIEDLIGDLGEDMVAHTPIPIPNVSEAVLR KVLEWCEHHRNDPALVSGENSESWKTTDIDEWDQLFMQVDLQMLFEIILASNYLDIEQLL QVGCKTVANMIKGKSPDEIHKAFNITSDLSLEVEKERVRRGDYGQNS NT seq 504 nt NT seq  +upstreamnt  +downstreamnt atggcggaggggcaacttcagaaggtgaaacttcagagcaacggtggccagaccatcgag gttgatcgcgccatcgcttgccgctcgcgcctgatcgaggacttgattggcgatcttggc gaggacatggttgcccatacgccgattccgattccgaatgtcagcgaggctgttctcaga aaagttctcgagtggtgcgagcaccaccgcaacgatcccgcgctggttagcggtgagaac agtgaaagctggaaaacgacggatatcgacgagtgggaccagttgtttatgcaagtcgac ctacaaatgctgttcgagatcattctggccagcaactacctcgatattgaacagcttttg caggtcggctgcaaaaccgtcgccaacatgatcaagggcaagtcgccggatgagatccat aaggcattcaacatcaccagcgaccttagcctcgaggtggagaaggagcgggtccgccgt ggtgattatgggcagaacagctag

DBGET integrated database retrieval system