Pantherophis guttatus (corn snake): 117669182 Help Entry 117669182         CDS       T07329                                  Symbol ELOB Name (RefSeq) elongin-B isoform X1   KO K03873   elongin-B Organism pgut  Pantherophis guttatus (corn snake) Pathway pgut04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:pgut00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     117669182 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pgut04121]     117669182 (ELOB)    03400 DNA repair and recombination proteins [BR:pgut03400]     117669182 (ELOB) Ubiquitin system [BR:pgut04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      117669182 (ELOB)    Cul5 complex      117669182 (ELOB) DNA repair and recombination proteins [BR:pgut03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      117669182 (ELOB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  117669182 NCBI-ProteinID:  XP_034279322 UniProt:  A0A6P9C7D6 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESSTVYELKRIVEGILKRPPEEQRLYKDDQLLDDSKTLGDC GFTSQTARPQAPATVGLAFRASEDVFENLRIDPFSSPPELPDVMKPQDSGSSANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtttttctaatgatccgacgtcacaagacaactatcttcacagatgccaaggaa tccagtacagtgtatgagctgaaaagaattgtggaggggattcttaagaggcctccagaa gaacagagattatacaaggatgatcaactgctggatgatagtaaaactcttggagactgc ggcttcaccagtcagacagcacggccccaggccccagcaacagtcggcttggccttcaga gccagtgaagatgtctttgagaatctccgcatcgatcccttctccagccctccagagctc ccagacgtgatgaagccccaggactctggcagcagtgctaatgagcaagcagtgcagtga

DBGET integrated database retrieval system