Pantherophis guttatus (corn snake): 117676114 Help Entry 117676114         CDS       T07329                                  Symbol TMSB4X Name (RefSeq) thymosin beta-4   KO K05764   thymosin, beta 4 Organism pgut  Pantherophis guttatus (corn snake) Pathway pgut04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:pgut00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     117676114 (TMSB4X)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pgut04812]     117676114 (TMSB4X) Cytoskeleton proteins [BR:pgut04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Thymosin      117676114 (TMSB4X) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thymosin WH2 Qua1 Motif Other DBs NCBI-GeneID:  117676114 NCBI-ProteinID:  XP_034291236 UniProt:  A0A6P9DG03 LinkDB All DBs Position Unknown AA seq 44 aa AA seqDB search MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaaaccagatatggctgaaattgagaaatttgacaagtctaagttgaagaag acagaaacgcaagagaaaaacccactgccttcaaaagaaacaattgaacaggagaagcaa gcgggtgaatcgtaa

DBGET integrated database retrieval system