Passer montanus (Eurasian tree sparrow): 120500147 Help Entry 120500147         CDS       T07277                                  Name (RefSeq) josephin-2-like   KO K15235   josephin [EC:3.4.19.12] Organism pmoa  Passer montanus (Eurasian tree sparrow) Brite KEGG Orthology (KO) [BR:pmoa00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:pmoa01002]     120500147   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pmoa04121]     120500147 Enzymes [BR:pmoa01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.19  Omega peptidases     3.4.19.12  ubiquitinyl hydrolase 1      120500147 Peptidases and inhibitors [BR:pmoa01002]  Cysteine peptidases   Family C86    120500147 Ubiquitin system [BR:pmoa04121]  Deubiquitinating enzyme (DUB)   Ubiquitin-specific proteases (UBPs)    MJD     120500147 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Josephin Motif Other DBs NCBI-GeneID:  120500147 NCBI-ProteinID:  XP_039560550 LinkDB All DBs Position Unknown AA seq 81 aa AA seqDB search GFGSGVPGVPYHERQRRQLCALHALNSLLQRPWLSQASADRLCQRLAPRSWPNPHRSPLG TGNYDVNVVMAALGSQGLAAV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt ggatttgggtctggggtcccgggggtgccgtaccacgagcggcagcgccggcagctctgc gccctgcacgccctcaacagcctcctgcagcggccctggctcagccaggcctcggccgac cgcctctgccagcggctggccccgcgctcgtggcccaacccccaccgcagcccgctgggc accggcaactacgacgtgaacgtggtgatggcggcgctgggctcgcaggggctggcggcc gtctga

DBGET integrated database retrieval system