Podarcis muralis (common wall lizard): 114585802 Help Entry 114585802         CDS       T06059                                  Name (RefSeq) C-C motif chemokine 4-like   KO K12964   C-C motif chemokine 4 Organism pmua  Podarcis muralis (common wall lizard) Pathway pmua04060   Cytokine-cytokine receptor interaction pmua04620   Toll-like receptor signaling pathway pmua04623   Cytosolic DNA-sensing pathway Brite KEGG Orthology (KO) [BR:pmua00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     114585802  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     114585802    04623 Cytosolic DNA-sensing pathway     114585802  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pmua04052]     114585802 Cytokines and neuropeptides [BR:pmua04052]  Cytokines   Chemokines    114585802 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  114585802 NCBI-ProteinID:  XP_028564514 LinkDB All DBs Position 15:complement(16593966..16596962) Genome browser AA seq 95 aa AA seqDB search MNASQSPRAWAVAALLVLALCLSASAAPVGSDPPTSCCFTYTAKKIPRNYIADFYETNSR CSQPGVVFTTKKGREICANPAEKWVQEYMDHFELN NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaatgcttctcaatctccacgtgcctgggctgtggccgccctcctggtactggccctc tgcctctcggccagcgctgctccagtggggtccgaccctccaacttcctgctgcttcacc tacacggcaaagaagatcccccggaactacattgctgacttttacgaaacaaacagcagg tgctctcagccaggtgttgtgttcaccacaaagaagggccgggagatctgtgccaacccc gcagagaaatgggtccaagaatacatggaccacttcgagctgaactga

DBGET integrated database retrieval system