Podarcis muralis (common wall lizard): 114596288 Help Entry 114596288         CDS       T06059                                  Symbol TMSB4X Name (RefSeq) thymosin beta-4   KO K05764   thymosin, beta 4 Organism pmua  Podarcis muralis (common wall lizard) Pathway pmua04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:pmua00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     114596288 (TMSB4X)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pmua04812]     114596288 (TMSB4X) Cytoskeleton proteins [BR:pmua04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Thymosin      114596288 (TMSB4X) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thymosin WH2 Qua1 Motif Other DBs NCBI-GeneID:  114596288 NCBI-ProteinID:  XP_028583525 LinkDB All DBs Position 4:complement(68931008..68933246) Genome browser AA seq 44 aa AA seqDB search MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaaaccagatatggctgaaatcgagaaattcgacaagtctaagttgaagaag acggaaacgcaagagaaaaacccactgccttcaaaagaaacaattgaacaggagaagcaa gcgggtgaatcgtaa

DBGET integrated database retrieval system