Pongo abelii (Sumatran orangutan): 100171479 Help Entry 100171479         CDS       T01416                                  Symbol CYCS Name (RefSeq) cytochrome c   KO K08738   cytochrome c Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon00190   Oxidative phosphorylation pon01100   Metabolic pathways pon01524   Platinum drug resistance pon04115   p53 signaling pathway pon04210   Apoptosis pon04215   Apoptosis - multiple species pon04932   Non-alcoholic fatty liver disease pon05010   Alzheimer disease pon05012   Parkinson disease pon05014   Amyotrophic lateral sclerosis pon05016   Huntington disease pon05017   Spinocerebellar ataxia pon05020   Prion disease pon05022   Pathways of neurodegeneration - multiple diseases pon05132   Salmonella infection pon05134   Legionellosis pon05145   Toxoplasmosis pon05152   Tuberculosis pon05160   Hepatitis C pon05161   Hepatitis B pon05162   Measles pon05163   Human cytomegalovirus infection pon05164   Influenza A pon05167   Kaposi sarcoma-associated herpesvirus infection pon05168   Herpes simplex virus 1 infection pon05169   Epstein-Barr virus infection pon05170   Human immunodeficiency virus 1 infection pon05200   Pathways in cancer pon05210   Colorectal cancer pon05222   Small cell lung cancer pon05416   Viral myocarditis pon05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pon00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     100171479 (CYCS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     100171479 (CYCS)    04215 Apoptosis - multiple species     100171479 (CYCS)    04115 p53 signaling pathway     100171479 (CYCS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100171479 (CYCS)   09162 Cancer: specific types    05210 Colorectal cancer     100171479 (CYCS)    05222 Small cell lung cancer     100171479 (CYCS)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100171479 (CYCS)    05161 Hepatitis B     100171479 (CYCS)    05160 Hepatitis C     100171479 (CYCS)    05164 Influenza A     100171479 (CYCS)    05162 Measles     100171479 (CYCS)    05168 Herpes simplex virus 1 infection     100171479 (CYCS)    05163 Human cytomegalovirus infection     100171479 (CYCS)    05167 Kaposi sarcoma-associated herpesvirus infection     100171479 (CYCS)    05169 Epstein-Barr virus infection     100171479 (CYCS)   09171 Infectious disease: bacterial    05132 Salmonella infection     100171479 (CYCS)    05134 Legionellosis     100171479 (CYCS)    05152 Tuberculosis     100171479 (CYCS)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100171479 (CYCS)   09164 Neurodegenerative disease    05010 Alzheimer disease     100171479 (CYCS)    05012 Parkinson disease     100171479 (CYCS)    05014 Amyotrophic lateral sclerosis     100171479 (CYCS)    05016 Huntington disease     100171479 (CYCS)    05017 Spinocerebellar ataxia     100171479 (CYCS)    05020 Prion disease     100171479 (CYCS)    05022 Pathways of neurodegeneration - multiple diseases     100171479 (CYCS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100171479 (CYCS)    05416 Viral myocarditis     100171479 (CYCS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100171479 (CYCS)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100171479 (CYCS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  100171479 NCBI-ProteinID:  NP_001124639 Ensembl:  ENSPPYG00000017719 UniProt:  Q5RFH4 A0A2J8VDX6 LinkDB All DBs Position 7:48431487..48433912 Genome browser AA seq 105 aa AA seqDB search MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIW GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaaaggcaagaagatttttattatgaagtgttcgcagtgccacacc gttgaaaagggaggcaagcacaagactgggccaaatctccatggtctcttcgggcggaag acaggtcaggcccctggatactcttacacagccgccaataaaaacaaaggcatcatctgg ggagaggatacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa atgatctttgtcggcattaagaagaaggaagaaagggcagacttaatagcttatctcaaa aaagctactaatgagtaa

DBGET integrated database retrieval system