Polaromonas sp. SP1: DT070_09585 Help Entry DT070_09585       CDS       T05689                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism pos  Polaromonas sp. SP1 Pathway pos00790   Folate biosynthesis pos01100   Metabolic pathways pos01240   Biosynthesis of cofactors Module pos_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:pos00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     DT070_09585 Enzymes [BR:pos01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      DT070_09585  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      DT070_09585  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      DT070_09585 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AYQ28243 LinkDB All DBs Position complement(2031259..2031630) Genome browser AA seq 123 aa AA seqDB search MFNTRGTQILNLTGLRFDANLGILDHEKTAPQPIQVDAELNLGTQPLLPHDDDINHVLDY RKVRQIIINECTAEHQNLLESLIGKLAHRLMQLPGVLGVRVKIAKLEIFDDCEVAIRVET GQW NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgttcaatacccggggcacccaaatcctgaacctcaccggtttgcgtttcgacgcgaac ctcggcattctggaccacgaaaaaaccgcgccgcagcccatccaggtcgatgccgagctg aacctgggcacgcagccgctgctgccccacgacgacgacatcaaccacgtgctggactac cgcaaggtgcgccagatcatcatcaacgaatgcacggcggaacaccagaacctgctggag agcctgatcggcaagctggcgcaccggctgatgcagctgcccggcgtgctgggcgtgcgg gtgaagattgccaaacttgaaatttttgacgactgcgaagtggccattcgcgtcgagacg ggacagtggtga

DBGET integrated database retrieval system