Panthera pardus (leopard): 109263839 Help Entry 109263839         CDS       T06062                                  Symbol NPY Name (RefSeq) pro-neuropeptide Y   KO K05232   neuropeptide Y Organism ppad  Panthera pardus (leopard) Pathway ppad04024   cAMP signaling pathway ppad04080   Neuroactive ligand-receptor interaction ppad04920   Adipocytokine signaling pathway ppad04923   Regulation of lipolysis in adipocytes ppad05034   Alcoholism Brite KEGG Orthology (KO) [BR:ppad00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     109263839 (NPY)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     109263839 (NPY)  09150 Organismal Systems   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     109263839 (NPY)    04920 Adipocytokine signaling pathway     109263839 (NPY)  09160 Human Diseases   09165 Substance dependence    05034 Alcoholism     109263839 (NPY)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ppad04052]     109263839 (NPY) Cytokines and neuropeptides [BR:ppad04052]  Neuropeptides   Neuropeptides (GPCR binding)    109263839 (NPY) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_3 Motif Other DBs NCBI-GeneID:  109263839 NCBI-ProteinID:  XP_019299157 Ensembl:  ENSPPRG00000009455 UniProt:  A0A9V1FB26 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MLGSKRLGLSGMTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLIT RQRYGKRSSPETLISDLLMRESTENVPRTRLEDPSMW NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgctgggtagcaagcgactggggctatccggaatgaccctcgccctgtccctgcttgtg tgcctgggcgcgctggccgaggcgtacccctccaagccagacaacccaggagaggacgcg ccggcagaggacatggccagatactattcagcgctgcgacactacatcaacctcatcacc aggcagaggtatggaaaacgatctagccctgagacactgatttcagacctcttgatgaga gaaagcacagaaaacgttcccagaactaggctggaagacccttctatgtggtga

DBGET integrated database retrieval system