Prunus persica (peach): 18785423 Help Entry 18785423          CDS       T03092                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism pper  Prunus persica (peach) Pathway pper03083   Polycomb repressive complex pper04120   Ubiquitin mediated proteolysis pper04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pper00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     18785423    04120 Ubiquitin mediated proteolysis     18785423   09126 Chromosome    03083 Polycomb repressive complex     18785423  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pper04131]     18785423    04121 Ubiquitin system [BR:pper04121]     18785423    03036 Chromosome and associated proteins [BR:pper03036]     18785423 Membrane trafficking [BR:pper04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     18785423 Ubiquitin system [BR:pper04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    SCF complex     Adaptor protein      18785423    Cul7 complex      18785423 Chromosome and associated proteins [BR:pper03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      18785423   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      18785423 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 Motif Other DBs NCBI-GeneID:  18785423 NCBI-ProteinID:  XP_007219678 UniProt:  M5X497 LinkDB All DBs Position G2:complement(24234360..24234785) Genome browser AA seq 141 aa AA seqDB search MSSSASKSRVVRLRSANNEIFEVEEAIVALSEPIKNLIDVIGVNHVIPMPDVRSKTLAMV IEWCKYHAASDQGPRNTKELIKEWEEELDQADLVIDLLCTASFLCIKDLQDQMFQRVADL IKVKTLEEICELFHVKNDFSS NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcgtcggcatcaaagagtagggttgtgaggttgaggagcgcaaacaatgaaata ttcgaagtagaagaagcaattgtagcactgtccgagcccatcaaaaacctcatcgacgtc atcggtgtcaaccatgtgataccaatgccagacgtgaggtccaaaaccctagccatggtg atagagtggtgcaagtaccatgctgcttctgatcagggccctagaaacactaaagaactc atcaaagagtgggaggaagagctcgaccaagctgacctcgtcattgatctcttatgcact gcaagctttctctgcatcaaggacttgcaagatcaaatgtttcaaagggttgccgatttg attaaagtgaagacacttgaggagatttgcgaattgtttcacgtcaaaaacgatttttct tcctag

DBGET integrated database retrieval system