Paludibacter propionicigenes: Palpr_0521 Help Entry Palpr_0521        CDS       T01362                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism ppn  Paludibacter propionicigenes Pathway ppn00020   Citrate cycle (TCA cycle) ppn00720   Other carbon fixation pathways ppn01100   Metabolic pathways ppn01110   Biosynthesis of secondary metabolites ppn01120   Microbial metabolism in diverse environments ppn01200   Carbon metabolism ppn01210   2-Oxocarboxylic acid metabolism Module ppn_M00009   Citrate cycle (TCA cycle, Krebs cycle) ppn_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:ppn00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     Palpr_0521   09102 Energy metabolism    00720 Other carbon fixation pathways     Palpr_0521 Enzymes [BR:ppn01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      Palpr_0521 SSDB OrthologParalogGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_2 Fer4_6 Fer4_21 Fer4_10 Fer4_9 Fer4_4 Fer4_16 Fer4_15 Fer4_17 Fer4_3 Fer4_8 LdpA_Fe-S-bd Fer4_22 Fer4_13 DUF2284 Motif Other DBs NCBI-ProteinID:  ADQ78680 UniProt:  E4T1T6 LinkDB All DBs Position complement(635509..635733) Genome browser AA seq 74 aa AA seqDB search MAKIKGAVVINVERCKGCNLCVVACPSNVLALNKEANSKGYNYSIMADADSCVGCAACAL VCPDACITVYKVRV NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggcaaaaattaaaggagcagttgttatcaatgttgaacgttgtaaaggctgtaatcta tgtgtagtggcttgtccatctaatgtattagcattaaacaaagaagcaaattcgaagggt tacaattatagtattatggctgatgcggattcatgtgttggttgtgctgcctgtgcatta gtttgcccggatgcatgtattaccgtctataaagtcagagtctga

DBGET integrated database retrieval system