Pieris rapae (cabbage white): 110993745 Help Entry 110993745         CDS       T05162                                  Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A [EC:3.6.5.2] Organism prap  Pieris rapae (cabbage white) Pathway prap04137   Mitophagy - animal prap04140   Autophagy - animal prap04142   Lysosome biogenesis prap04144   Endocytosis prap04145   Phagocytosis prap04148   Efferocytosis Brite KEGG Orthology (KO) [BR:prap00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     110993745    04145 Phagocytosis     110993745    04142 Lysosome biogenesis     110993745    04140 Autophagy - animal     110993745    04137 Mitophagy - animal     110993745    04148 Efferocytosis     110993745  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:prap04131]     110993745   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:prap04147]     110993745    04031 GTP-binding proteins [BR:prap04031]     110993745 Enzymes [BR:prap01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.5  Acting on GTP to facilitate cellular and subcellular movement     3.6.5.2  small monomeric GTPase      110993745 Membrane trafficking [BR:prap04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     110993745  Endosome - Golgi transport     110993745 Exosome [BR:prap04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110993745   Exosomal proteins of other body fluids (saliva and urine)    110993745   Exosomal proteins of colorectal cancer cells    110993745   Exosomal proteins of bladder cancer cells    110993745 GTP-binding proteins [BR:prap04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     110993745 SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase ATP_bind_1 nSTAND3 cobW Septin AAA_16 PduV-EutP AAA_22 NACHT AAA_7 AAA_5 ATPase_2 AAA_24 NTPase_1 SRPRB G-alpha NB-ARC ABC_tran AAA_14 ATP-synt_ab TniB RNA_helicase PRK Motif Other DBs NCBI-GeneID:  110993745 NCBI-ProteinID:  XP_022115800 LinkDB All DBs Position 12:4930396..4931670 Genome browser AA seq 208 aa AA seqDB search MSSRKKVLLKVIILGDSGVGKTSLMNQFVNKKFSNQYKATIGADFLTKEVIVDDRIVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKSLESWRDEFLIQASPRDPDHFPF VILGNKVDLDNRAVSAKRAQQWCQSKNDIPYFETSAKEAVNVELAFQTIARNALAQETEA ELYNEFPDQIKLNANDNNRNRDGDNCAC NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atgtcttcgagaaaaaaggttcttctaaaggtaataattctaggcgatagtggggttggc aaaacttcacttatgaatcagtttgtcaacaagaaattttccaatcagtacaaggctacc ataggcgcagattttctcacgaaggaggtaattgttgatgataggattgtcacaatgcaa atttgggatacagcaggtcaagagcgttttcaatcattgggggtggccttctaccgtgga gcggattgctgcgtattagtgtttgacgtaacggcccctaacacgttcaagtccttggag agctggcgagatgagttcttgatacaagcatcgcctcgtgaccctgaccatttcccgttt gtcatcctaggtaataaagtcgatttggataatcgtgccgtttctgccaaacgtgctcag cagtggtgtcagagtaaaaatgatataccctattttgaaaccagtgccaaagaagcagtc aatgtagaattagcattccaaaccattgctcgtaatgcattggcacaggaaacagaggca gaactgtataatgagtttccagaccaaattaaactgaatgccaatgataacaatcgcaac agggatggagacaactgtgcttgctag

DBGET integrated database retrieval system