Polypterus senegalus (gray bichir): 120542718 Help Entry 120542718         CDS       T08668                                  Symbol tmsb2 Name (RefSeq) thymosin beta-12   KO K05764   thymosin, beta 4 Organism psex  Polypterus senegalus (gray bichir) Pathway psex04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:psex00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     120542718 (tmsb2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:psex04812]     120542718 (tmsb2) Cytoskeleton proteins [BR:psex04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Thymosin      120542718 (tmsb2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thymosin WH2 Motif Other DBs NCBI-GeneID:  120542718 NCBI-ProteinID:  XP_039631285 LinkDB All DBs Position 13:complement(11841755..11857118) Genome browser AA seq 45 aa AA seqDB search MSDKPDLAEIESFDKSKLKKTETKERNPLPTKEIIEQEKKADTTP NT seq 138 nt NT seq  +upstreamnt  +downstreamnt atgtctgataaaccagatctcgcagaaattgagagcttcgacaagtccaaactgaagaag acagagaccaaagaacggaatccgttgccgacaaaagaaattattgagcaagaaaagaag gctgatactactccctga

DBGET integrated database retrieval system