Pseudoxanthomonas suwonensis J1: WQ53_11315 Help Entry WQ53_11315        CDS       T04241                                  Name (GenBank) DNA polymerase III subunit chi   KO K02339   DNA polymerase III subunit chi [EC:2.7.7.7] Organism psuw  Pseudoxanthomonas suwonensis J1 Pathway psuw03030   DNA replication psuw03430   Mismatch repair psuw03440   Homologous recombination Brite KEGG Orthology (KO) [BR:psuw00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     WQ53_11315    03430 Mismatch repair     WQ53_11315    03440 Homologous recombination     WQ53_11315  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:psuw03032]     WQ53_11315    03400 DNA repair and recombination proteins [BR:psuw03400]     WQ53_11315 Enzymes [BR:psuw01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      WQ53_11315 DNA replication proteins [BR:psuw03032]  Prokaryotic type   DNA Replication Elongation Factors    Elongation factors (bacterial)     DNA polymerase III holoenzyme      WQ53_11315 DNA repair and recombination proteins [BR:psuw03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA polymerase III holoenzyme      WQ53_11315 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol3_chi Motif Other DBs NCBI-ProteinID:  AKC87248 UniProt:  A0A0E3Z1Q9 LinkDB All DBs Position complement(2712775..2713197) Genome browser AA seq 140 aa AA seqDB search MPRADFYLIAKPRFADQPLLLVCELARRACDGNQFTVVLARDQAQAEELDDLLWSFDPDA YIPHQIAGDEEDELAPVLIVPPGTEAPPRPLAINLRDAAWTAPCERVLEVVPADPAARGP LRERWKQYQALGYDLNKHDM NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atgccacgcgccgacttctatctcatcgccaagccgcgcttcgcggaccagccgctgctg ctggtctgcgagctggcgcggcgcgcctgcgacggcaaccagttcaccgtggtgctggcg cgtgaccaggcccaggccgaggaactggacgacctgctgtggtcgttcgatccggacgcc tacatcccgcaccagatcgccggcgacgaggaggacgagctggccccggtgctgatcgtt ccgcccggcaccgaggcgccgccgcggccgctggcgatcaacctgcgcgatgcggcctgg accgccccctgcgagcgcgtgctcgaggtggtgccggccgatccggccgcgcgcggaccg ctgcgcgagcgctggaagcagtaccaggcgctgggctacgacctcaacaagcacgacatg taa

DBGET integrated database retrieval system