Panthera tigris altaica (Amur tiger): 102952117 Help Entry 102952117         CDS       T02988                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04613   Neutrophil extracellular trap formation ptg05034   Alcoholism ptg05202   Transcriptional misregulation in cancer ptg05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ptg00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102952117  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     102952117   09163 Immune disease    05322 Systemic lupus erythematosus     102952117   09165 Substance dependence    05034 Alcoholism     102952117  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ptg03036]     102952117   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptg04147]     102952117 Chromosome and associated proteins [BR:ptg03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102952117 Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102952117 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  102952117 NCBI-ProteinID:  XP_007075488 LinkDB All DBs Position Un AA seq 82 aa AA seqDB search PKSPPALLPRNLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIH AKRVTIMPKDIQLARRIRGERA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt cccaaaagccccccggcgctgctgccccgcaacctgccgttccagcggctggtgcgcgag atcgcgcaggacttcaagacggacctgcgcttccagagctcggccgtgatggcgctgcag gaggcgagcgaggcctacctggtggggctgttcgaggacacgaacctgtgcgccatccac gccaagcgcgtcaccatcatgcccaaggacatccagctggctcgccgcatccgcggggag cgggcttaa

DBGET integrated database retrieval system