Pan troglodytes (chimpanzee): 745954 Help Entry 745954            CDS       T01005                                  Symbol GSTP1 Name (RefSeq) glutathione S-transferase P   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr00480   Glutathione metabolism ptr00980   Metabolism of xenobiotics by cytochrome P450 ptr00982   Drug metabolism - cytochrome P450 ptr00983   Drug metabolism - other enzymes ptr01100   Metabolic pathways ptr01524   Platinum drug resistance ptr05200   Pathways in cancer ptr05204   Chemical carcinogenesis - DNA adducts ptr05215   Prostate cancer ptr05225   Hepatocellular carcinoma ptr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ptr00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     745954 (GSTP1)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     745954 (GSTP1)    00982 Drug metabolism - cytochrome P450     745954 (GSTP1)    00983 Drug metabolism - other enzymes     745954 (GSTP1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     745954 (GSTP1)    05204 Chemical carcinogenesis - DNA adducts     745954 (GSTP1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     745954 (GSTP1)    05215 Prostate cancer     745954 (GSTP1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     745954 (GSTP1)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     745954 (GSTP1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ptr02000]     745954 (GSTP1) Enzymes [BR:ptr01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      745954 (GSTP1) Transporters [BR:ptr02000]  Other transporters   Pores ion channels [TC:1]    745954 (GSTP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_2 GST_N_2 Motif Other DBs NCBI-GeneID:  745954 NCBI-ProteinID:  XP_001152516 Ensembl:  ENSPTRG00000003968 VGNC:  6750 UniProt:  H2R572 A0A6D2XMS2 LinkDB All DBs Position 11:63541524..63544573 Genome browser AA seq 210 aa AA seqDB search MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGD LTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYV KALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAY VGRLSARPKLKAFLASPEYVNLPINGNGKQ NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgccgccctacaccgtggtctatttcccagttcgaggccgctgcgcggccctgcgcatg ctgctggcagatcagggccagagctggaaggaggaggtggtgaccgtggagacgtggcag gagggctcactcaaagcctcctgcctatacgggcagctccccaagttccaggacggagac ctcaccctgtaccagtccaataccatcctgcgtcacctgggccgcacccttgggctctat gggaaggaccagcaggaggcagccctggtggacatggtgaatgacggcgtggaggacctc cgctgcaaatacgtctccctcatctacaccaactatgaggcgggcaaggatgactatgtg aaggcactgcccgggcaactgaagccttttgagaccctgctgtcccagaaccagggaggc aagaccttcattgtgggagaccagatctccttcgctgactacaacctgctggacttgctg ctgatccatgaggtcctagcccctggctgcctggatgcgttccccctgctctcagcatat gtggggcgcctcagcgcccggcccaagctcaaggccttcctggcctcccctgagtacgtg aacctccccatcaatggcaacgggaaacagtga

DBGET integrated database retrieval system