Panthera uncia (snow leopard): 125912163 Help Entry 125912163         CDS       T08832                                  Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism puc  Panthera uncia (snow leopard) Pathway puc01523   Antifolate resistance puc04010   MAPK signaling pathway puc04014   Ras signaling pathway puc04024   cAMP signaling pathway puc04062   Chemokine signaling pathway puc04064   NF-kappa B signaling pathway puc04066   HIF-1 signaling pathway puc04071   Sphingolipid signaling pathway puc04137   Mitophagy - animal puc04151   PI3K-Akt signaling pathway puc04210   Apoptosis puc04211   Longevity regulating pathway puc04218   Cellular senescence puc04380   Osteoclast differentiation puc04613   Neutrophil extracellular trap formation puc04620   Toll-like receptor signaling pathway puc04621   NOD-like receptor signaling pathway puc04622   RIG-I-like receptor signaling pathway puc04623   Cytosolic DNA-sensing pathway puc04625   C-type lectin receptor signaling pathway puc04657   IL-17 signaling pathway puc04658   Th1 and Th2 cell differentiation puc04659   Th17 cell differentiation puc04660   T cell receptor signaling pathway puc04662   B cell receptor signaling pathway puc04668   TNF signaling pathway puc04722   Neurotrophin signaling pathway puc04917   Prolactin signaling pathway puc04920   Adipocytokine signaling pathway puc04926   Relaxin signaling pathway puc04931   Insulin resistance puc04932   Non-alcoholic fatty liver disease puc04933   AGE-RAGE signaling pathway in diabetic complications puc04936   Alcoholic liver disease puc05010   Alzheimer disease puc05022   Pathways of neurodegeneration - multiple diseases puc05030   Cocaine addiction puc05132   Salmonella infection puc05133   Pertussis puc05134   Legionellosis puc05135   Yersinia infection puc05140   Leishmaniasis puc05142   Chagas disease puc05145   Toxoplasmosis puc05146   Amoebiasis puc05152   Tuberculosis puc05160   Hepatitis C puc05161   Hepatitis B puc05162   Measles puc05163   Human cytomegalovirus infection puc05164   Influenza A puc05165   Human papillomavirus infection puc05166   Human T-cell leukemia virus 1 infection puc05167   Kaposi sarcoma-associated herpesvirus infection puc05168   Herpes simplex virus 1 infection puc05169   Epstein-Barr virus infection puc05170   Human immunodeficiency virus 1 infection puc05171   Coronavirus disease - COVID-19 puc05200   Pathways in cancer puc05202   Transcriptional misregulation in cancer puc05203   Viral carcinogenesis puc05207   Chemical carcinogenesis - receptor activation puc05208   Chemical carcinogenesis - reactive oxygen species puc05212   Pancreatic cancer puc05215   Prostate cancer puc05220   Chronic myeloid leukemia puc05221   Acute myeloid leukemia puc05222   Small cell lung cancer puc05235   PD-L1 expression and PD-1 checkpoint pathway in cancer puc05321   Inflammatory bowel disease puc05415   Diabetic cardiomyopathy puc05417   Lipid and atherosclerosis puc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:puc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     125912163    04014 Ras signaling pathway     125912163    04064 NF-kappa B signaling pathway     125912163    04668 TNF signaling pathway     125912163    04066 HIF-1 signaling pathway     125912163    04071 Sphingolipid signaling pathway     125912163    04024 cAMP signaling pathway     125912163    04151 PI3K-Akt signaling pathway     125912163  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     125912163   09143 Cell growth and death    04210 Apoptosis     125912163    04218 Cellular senescence     125912163  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     125912163    04620 Toll-like receptor signaling pathway     125912163    04621 NOD-like receptor signaling pathway     125912163    04622 RIG-I-like receptor signaling pathway     125912163    04623 Cytosolic DNA-sensing pathway     125912163    04625 C-type lectin receptor signaling pathway     125912163    04660 T cell receptor signaling pathway     125912163    04658 Th1 and Th2 cell differentiation     125912163    04659 Th17 cell differentiation     125912163    04657 IL-17 signaling pathway     125912163    04662 B cell receptor signaling pathway     125912163    04062 Chemokine signaling pathway     125912163   09152 Endocrine system    04920 Adipocytokine signaling pathway     125912163    04917 Prolactin signaling pathway     125912163    04926 Relaxin signaling pathway     125912163   09156 Nervous system    04722 Neurotrophin signaling pathway     125912163   09158 Development and regeneration    04380 Osteoclast differentiation     125912163   09149 Aging    04211 Longevity regulating pathway     125912163  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125912163    05202 Transcriptional misregulation in cancer     125912163    05207 Chemical carcinogenesis - receptor activation     125912163    05208 Chemical carcinogenesis - reactive oxygen species     125912163    05203 Viral carcinogenesis     125912163    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     125912163   09162 Cancer: specific types    05212 Pancreatic cancer     125912163    05221 Acute myeloid leukemia     125912163    05220 Chronic myeloid leukemia     125912163    05215 Prostate cancer     125912163    05222 Small cell lung cancer     125912163   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     125912163    05170 Human immunodeficiency virus 1 infection     125912163    05161 Hepatitis B     125912163    05160 Hepatitis C     125912163    05171 Coronavirus disease - COVID-19     125912163    05164 Influenza A     125912163    05162 Measles     125912163    05168 Herpes simplex virus 1 infection     125912163    05163 Human cytomegalovirus infection     125912163    05167 Kaposi sarcoma-associated herpesvirus infection     125912163    05169 Epstein-Barr virus infection     125912163    05165 Human papillomavirus infection     125912163   09171 Infectious disease: bacterial    05132 Salmonella infection     125912163    05135 Yersinia infection     125912163    05133 Pertussis     125912163    05134 Legionellosis     125912163    05152 Tuberculosis     125912163   09174 Infectious disease: parasitic    05146 Amoebiasis     125912163    05145 Toxoplasmosis     125912163    05140 Leishmaniasis     125912163    05142 Chagas disease     125912163   09163 Immune disease    05321 Inflammatory bowel disease     125912163   09164 Neurodegenerative disease    05010 Alzheimer disease     125912163    05022 Pathways of neurodegeneration - multiple diseases     125912163   09165 Substance dependence    05030 Cocaine addiction     125912163   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125912163    05418 Fluid shear stress and atherosclerosis     125912163    05415 Diabetic cardiomyopathy     125912163   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     125912163    04932 Non-alcoholic fatty liver disease     125912163    04931 Insulin resistance     125912163    04933 AGE-RAGE signaling pathway in diabetic complications     125912163   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     125912163  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:puc03000]     125912163 Transcription factors [BR:puc03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     125912163 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  125912163 NCBI-ProteinID:  XP_049472392 LinkDB All DBs Position D1:5762049..5770646 Genome browser AA seq 555 aa AA seqDB search MDDLFPLIFPTEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLPPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSSAAVPKPAPQPYPFTPSLSTINF EEFSPMVFSSGQIPSQTPALAPAPAPILAPAPASVPAPAPVPGPGPAPAPAPAPILAPGL AQALVPPAPKTTQAGEGTLTEALLQLQFDADEDLGALLGNSADPAVFTDLASVDNSEFQQ LLSQGVSVAPHPAEPMLMEYPEAITRLVTGSQRPPDPAPAPLGASGLPNGLLSGDEDFSS IADMDFSALLSQISS NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt atggacgacctgtttcccctcatcttcccgactgagccggcccaggcctctggcccttat gtggagatcatcgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggt cgctccgcgggcagtatccccggcgagaggagcacggataccaccaagacccaccccacc atcaagatcaatggctacaccgggccagggacagttcgcatctcattggtcaccaaggac ccccctcatcggcctcacccccatgagctggtgggaaaagactgccgggatggcttctat gaggctgagctctgcccagaccgctgcatccacagcttccagaacctggggatccagtgt gtaaagaagcgggacctggagcaggccatcagtcaacgtatccagaccaacaacaatccc ttccaagttcccatagaagaacagcgtggggactacgacctgaatgcggtgcggctctgc ttccaggtgacagtgcgggacccggcaggcaggcccctccgcttgccgcccgtcctctcg catcccatctttgacaaccgtgcccccaacaccgccgagctcaagatctgccgagtgaac cgaaactcagggagctgcctcgggggggatgagatcttcctgctgtgtgacaaggtgcag aaagaggacattgaagtgtatttcacgggacccggctgggaggcccgaggctccttttct caagctgacgtacaccgacaagtggccattgtgttccggacacctccctatgccgacccc agcctgcaggcccccgtgcgtgtctccatgcagctgcggcggccttcagatcgggagctc agcgagcccatggaatttcagtacttgccagacacagatgatcgtcaccggattgaggag aaacgcaaaaggacatacgagaccttcaagagcatcatgaaaaagagtcctttcaatgga cccaccgacccccggcctccaccccggcgcatcgctgtgccttcccgaagctcagctgcc gtccccaagccagctccccagccctatccctttacgccatccctcagcaccatcaacttc gaggagttctcccccatggtcttctcttccgggcagatcccgagccagacccctgccttg gcaccagcccctgccccaatcctggccccggcccctgcctctgtcccggcccccgccccg gtccccggccccggccccgcccccgcccccgccccggcccccatcttagccccaggcctt gctcaggctctggtcccgcctgctcccaagaccacccaggctggggaagggacgctgacg gaggccctgctgcagctgcagtttgacgctgatgaagacctgggggccctgcttggcaac agcgccgacccggcagtgttcacagacctggcatccgtcgacaactctgagtttcagcag ctgctgagccagggggtatctgtggccccccacccagctgagcccatgctgatggaatac cctgaggcaataactcgcctggtgacgggatcccagaggccccctgacccagctcccgct cccctgggggcctcggggcttcccaacggcctcctctcgggggatgaagacttctcttcc attgccgacatggacttctcagcccttctgagtcagatcagctcctaa

DBGET integrated database retrieval system