Pteropus vampyrus (large flying fox): 105301261 Help Entry 105301261         CDS       T07815                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04146   Peroxisome pvp04213   Longevity regulating pathway - multiple species pvp05012   Parkinson disease pvp05014   Amyotrophic lateral sclerosis pvp05016   Huntington disease pvp05020   Prion disease pvp05022   Pathways of neurodegeneration - multiple diseases pvp05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:pvp00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     105301261 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     105301261 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     105301261 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     105301261 (SOD1)    05014 Amyotrophic lateral sclerosis     105301261 (SOD1)    05016 Huntington disease     105301261 (SOD1)    05020 Prion disease     105301261 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     105301261 (SOD1) Enzymes [BR:pvp01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      105301261 (SOD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  105301261 NCBI-ProteinID:  XP_011372147 UniProt:  A0A6P3RD74 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MTTKAVCVLKGDGKVQGTIHFEQKRNGLVVVSGTITGLTEGDHGFHVHQFGDNTQGCTSA GPHFNPLGKTHGGPKDEERHVGDLGNVTAGKDGMAHVHIEDSMIALSGDHSIIGRTMVVH EKPDDLGKGENDESKKTGNAGSRLACGVIGIAQ NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgacgaccaaggccgtgtgtgtgttgaagggcgatgggaaggtgcagggcaccatccac ttcgagcagaagagaaatgggctggtcgtggtctcgggaaccatcacaggattgactgaa ggtgaccatgggttccacgtccatcagttcggggataatacacaaggctgtaccagtgca ggtcctcacttcaatccacttggcaaaacacatggtgggccaaaggatgaagagaggcat gttggcgacctgggcaacgtgactgccggcaaagatgggatggctcacgtgcacatcgaa gactctatgattgccctctcgggagaccattccatcattggccgcactatggtggtccat gaaaaaccagatgacttgggcaaaggtgaaaatgatgaaagtaaaaagacgggaaatgct ggaagtcgtttggcttgtggtgtcattgggatcgcccagtaa

DBGET integrated database retrieval system