Rhodococcus jostii: RHA1_ro01020 Help Entry RHA1_ro01020      CDS       T00382                                  Name (GenBank) possible tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism rha  Rhodococcus jostii Pathway rha00362   Benzoate degradation rha00621   Dioxin degradation rha00622   Xylene degradation rha01100   Metabolic pathways rha01120   Microbial metabolism in diverse environments rha01220   Degradation of aromatic compounds Module rha_M00569   Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA Brite KEGG Orthology (KO) [BR:rha00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     RHA1_ro01020    00622 Xylene degradation     RHA1_ro01020    00621 Dioxin degradation     RHA1_ro01020 Enzymes [BR:rha01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      RHA1_ro01020 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 DUF1542 Tautomerase_3 GA Motif Other DBs NCBI-ProteinID:  ABG92847 UniProt:  Q0SHY9 LinkDB All DBs Position complement(1086883..1087062) Genome browser AA seq 59 aa AA seqDB search MPLIQISQTPGLTAEQKRATIEAVTQAYADATGKDPAKVWVTITEVPRDSWGVGGTPLG NT seq 180 nt NT seq  +upstreamnt  +downstreamnt atgccattgattcagatcagtcagacaccggggctcaccgcggagcagaagcgcgcgacg atcgaggcggtcacccaggcctacgccgatgcgacgggcaaggatcccgcgaaggtgtgg gtgacgatcaccgaggtcccgcgcgacagctggggtgtcggcgggacgccgctggggtga

DBGET integrated database retrieval system