Rhodoferax sediminis CHu59-6-5: EUB48_10130 Help Entry EUB48_10130       CDS       T06165                                  Name (GenBank) DNA polymerase III subunit chi   KO K02339   DNA polymerase III subunit chi [EC:2.7.7.7] Organism rhf  Rhodoferax sediminis CHu59-6-5 Pathway rhf03030   DNA replication rhf03430   Mismatch repair rhf03440   Homologous recombination Brite KEGG Orthology (KO) [BR:rhf00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     EUB48_10130    03430 Mismatch repair     EUB48_10130    03440 Homologous recombination     EUB48_10130  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:rhf03032]     EUB48_10130    03400 DNA repair and recombination proteins [BR:rhf03400]     EUB48_10130 Enzymes [BR:rhf01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      EUB48_10130 DNA replication proteins [BR:rhf03032]  Prokaryotic type   DNA Replication Elongation Factors    Elongation factors (bacterial)     DNA polymerase III holoenzyme      EUB48_10130 DNA repair and recombination proteins [BR:rhf03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA polymerase III holoenzyme      EUB48_10130 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol3_chi DUF5367 Motif Other DBs NCBI-ProteinID:  QDL37588 UniProt:  A0A515DAY2 LinkDB All DBs Position 2105562..2105996 Genome browser AA seq 144 aa AA seqDB search MTEVAFHFNTPDKVAYACRLLRKAVSSGAKVVVTAGANDLQMLDVALWTFAPLEFVPHCR ASANAAVLAASPVMLTDAVPAAPHQQVLVNLGEQVPDGFERFERLIEIVGLQDDDRLQAR SRWKHYADRGYAITRHDLAARSSS NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atgaccgaagttgccttccacttcaacacacccgataaggtggcctatgcctgccggctt ttgcgcaaggcggtgagcagcggggccaaggtcgtggtgacggccggggccaacgatctg cagatgctggatgtggcgctgtggacttttgcgccccttgaattcgtgccgcattgccgg gcttcagccaacgcagcggtgctggcggcatcgcccgtgatgctgacggacgcggtacct gccgcgccgcatcagcaggttctggtcaacttgggagaacaggtgccggacgggttcgag cgcttcgagcggttgatcgaaatcgttggcctgcaggacgatgatcgcctgcaggcccgc agccgctggaagcactacgccgaccgcggctatgccatcacccgtcacgaccttgcagcc aggagcagcagctga

DBGET integrated database retrieval system