Rhopalosiphum maidis (corn leaf aphid): 113548046 Help Entry 113548046         CDS       T06065                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism rmd  Rhopalosiphum maidis (corn leaf aphid) Pathway rmd04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:rmd00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     113548046  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:rmd04121]     113548046    03400 DNA repair and recombination proteins [BR:rmd03400]     113548046 Ubiquitin system [BR:rmd04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      113548046    Cul5 complex      113548046 DNA repair and recombination proteins [BR:rmd03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      113548046 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Motif Other DBs NCBI-GeneID:  113548046 NCBI-ProteinID:  XP_026804500 LinkDB All DBs Position 1:complement(58572254..58576526) Genome browser AA seq 116 aa AA seqDB search MDAFMMIQRKKLTIFTDAKDNILVNELKKIIGCIIKVAPSNQQLYYKDEIMDGSKTLSEC GLNSSIAKAQSPATIGLALKMDNGEFEPLEMVPYSLPPELPYVMKNQETNGQEPPM NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggacgctttcatgatgatacaacgaaaaaagctaaccatatttactgatgctaaagac aatatactggttaatgaactcaaaaagattattggatgtatcattaaagtagcaccatca aatcaacaactttactacaaagatgaaattatggatgggtcaaaaacgttgtcagaatgt ggtttaaattctagtattgctaaggcacaaagtccagctactattggcttagcattgaag atggataatggagaatttgagccattagaaatggtcccatattcattgccacctgaattg ccatatgtgatgaaaaaccaagaaactaatggtcaagaaccacccatgtaa

DBGET integrated database retrieval system