Cereibacter sphaeroides ATCC 17029: Rsph17029_1125 Help Entry Rsph17029_1125    CDS       T00484                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rsh  Cereibacter sphaeroides ATCC 17029 Pathway rsh01100   Metabolic pathways rsh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rsh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Rsph17029_1125   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Rsph17029_1125 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  ABN76235 UniProt:  A3PIR9 LinkDB All DBs Position 1:1170064..1170297 Genome browser AA seq 77 aa AA seqDB search MSDIADRVKKIVVEHLGVEEEKVTENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFISEAA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacatcgctgatcgcgtgaagaagatcgtcgtcgagcatctgggcgtcgaagag gagaaggtgaccgagaatgcctcgttcatcgacgacctcggcgcggacagcctcgacacg gtcgagctcgtgatggccttcgaggaagagttcggcattgagatcccggacgatgcggcc gaaaccatccagaccttcggcgatgcggtgaagttcatctcggaagccgcctga

DBGET integrated database retrieval system