Rhincodon typus (whale shark): 125484474 Help Entry 125484474         CDS       T06055                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism rtp  Rhincodon typus (whale shark) Pathway rtp04060   Cytokine-cytokine receptor interaction rtp04218   Cellular senescence rtp04620   Toll-like receptor signaling pathway rtp04621   NOD-like receptor signaling pathway rtp04622   RIG-I-like receptor signaling pathway rtp05132   Salmonella infection Brite KEGG Orthology (KO) [BR:rtp00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125484474  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     125484474  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     125484474    04621 NOD-like receptor signaling pathway     125484474    04622 RIG-I-like receptor signaling pathway     125484474  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125484474  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:rtp04052]     125484474    00536 Glycosaminoglycan binding proteins [BR:rtp00536]     125484474 Cytokines and neuropeptides [BR:rtp04052]  Cytokines   Chemokines    125484474 Glycosaminoglycan binding proteins [BR:rtp00536]  Heparan sulfate / Heparin   Chemokines    125484474 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  125484474 NCBI-ProteinID:  XP_048459297 LinkDB All DBs Position 1:complement(111701558..111703415) Genome browser AA seq 91 aa AA seqDB search MNRATIAMICILLLCAIVAQGTGGQCLCPKTSTNFINPRTIKTLRYIPKGSHCHKWEIIV TKKSGQKVCVSPDAKWVKIIIKSRKDFRPHN NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaacagagctactattgcaatgatttgcatcctgctcctgtgtgctattgttgcacag ggtactggaggacagtgtctgtgccccaagaccagcaccaattttatcaatccgagaacc atcaagactttacgatatattcccaaaggatcacattgtcataaatgggagataatcgtt accaagaaaagtgggcagaaagtttgtgtgagccctgatgccaagtgggtgaagattatc attaaatccaggaaagatttcagaccacataactaa

DBGET integrated database retrieval system