Sinocyclocheilus anshuiensis: 107697469 Help Entry 107697469         CDS       T04917                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism sanh  Sinocyclocheilus anshuiensis Pathway sanh04060   Cytokine-cytokine receptor interaction sanh04218   Cellular senescence sanh04620   Toll-like receptor signaling pathway sanh04621   NOD-like receptor signaling pathway sanh04622   RIG-I-like receptor signaling pathway sanh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sanh00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     107697469  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     107697469  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107697469    04621 NOD-like receptor signaling pathway     107697469    04622 RIG-I-like receptor signaling pathway     107697469  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107697469  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sanh04052]     107697469    00536 Glycosaminoglycan binding proteins [BR:sanh00536]     107697469 Cytokines and neuropeptides [BR:sanh04052]  Cytokines   Chemokines    107697469 Glycosaminoglycan binding proteins [BR:sanh00536]  Heparan sulfate / Heparin   Chemokines    107697469 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  107697469 NCBI-ProteinID:  XP_016353762 UniProt:  A0A671SQF4 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MNAFLMLTVIGASIVLSDAVQPLGAGYNSRCVCLRLESRIIPQENLRRVEILPRGPHCKT TEVIAGLSSGERICLNPRTPWVKKLILFIERKERATKKE NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaacgccttcctgatgttaaccgtaattggagccagcatcgttctgtccgatgccgtg cagcctctgggtgcgggctacaacagccgctgtgtgtgtctgagactggagtcacggatc atacctcaggaaaacctgcgccgcgtggagatcctgcccagaggcccacactgcaagacc actgaggttattgctggtttatcgagtggagagaggatctgtctgaaccccaggacacca tgggttaaaaaactcattctgttcattgagagaaaggagcgagcgaccaagaaagagtag

DBGET integrated database retrieval system