Sorex araneus (European shrew): 101540260 Help Entry 101540260         CDS       T07854                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism sara  Sorex araneus (European shrew) Pathway sara04146   Peroxisome sara04213   Longevity regulating pathway - multiple species sara05012   Parkinson disease sara05014   Amyotrophic lateral sclerosis sara05016   Huntington disease sara05020   Prion disease sara05022   Pathways of neurodegeneration - multiple diseases sara05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:sara00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     101540260 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     101540260 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     101540260 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     101540260 (SOD1)    05014 Amyotrophic lateral sclerosis     101540260 (SOD1)    05016 Huntington disease     101540260 (SOD1)    05020 Prion disease     101540260 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     101540260 (SOD1) Enzymes [BR:sara01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      101540260 (SOD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  101540260 NCBI-ProteinID:  XP_004620409 LinkDB All DBs Position Unknown AA seq 174 aa AA seqDB search MFFAIWGITKAAAPRTHKPDCQLQPLLALFFLFCSGFVFLSLVHLGNGPVKVSGSISGLT EGQHGFHVHQFGDNTQGCTSAGPHFNPFAKKHGGPKDQERHVGDLGNVTAGKDGVATVSI QDAMITLCGDHSIIGRTMVVHEKEDDLGKGGNEESTKTGNAGGRLACGVIGIAQ NT seq 525 nt NT seq  +upstreamnt  +downstreamnt atgttctttgctatttggggcattaccaaagctgcagccccccgaacccacaagccagac tgccagctacagcctctgctggccttgttcttcctcttctgctctggtttcgtgttcctg tccctcgtccacctggggaatgggcctgtgaaggtgtcggggtccatttccgggcttact gaaggccagcacggattccacgtccatcagttcggagataacacacaaggctgtaccagt gcaggccctcactttaatcctttcgccaaaaagcatggtgggccaaaggaccaagagaga catgttggagacctggggaatgtgactgcaggcaaagatggtgtggccactgtgtctatt caggacgccatgatcactctctgcggagatcattccatcattggccgcaccatggtggtc catgaaaaagaagatgacttgggcaaaggtggaaatgaagaaagtacaaagacaggaaac gctggaggtcgcttggcttgtggtgtcatcggaatcgcccagtaa

DBGET integrated database retrieval system