Salmo salar (Atlantic salmon): 106595660 Help Entry 106595660         CDS       T04363                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04060   Cytokine-cytokine receptor interaction sasa04218   Cellular senescence sasa04620   Toll-like receptor signaling pathway sasa04621   NOD-like receptor signaling pathway sasa04622   RIG-I-like receptor signaling pathway sasa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     106595660  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     106595660  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     106595660    04621 NOD-like receptor signaling pathway     106595660    04622 RIG-I-like receptor signaling pathway     106595660  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106595660  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sasa04052]     106595660    00536 Glycosaminoglycan binding proteins [BR:sasa00536]     106595660 Cytokines and neuropeptides [BR:sasa04052]  Cytokines   Chemokines    106595660 Glycosaminoglycan binding proteins [BR:sasa00536]  Heparan sulfate / Heparin   Chemokines    106595660 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  106595660 NCBI-ProteinID:  XP_014042500 UniProt:  B5X6N7 LinkDB All DBs Position Un Genome browser AA seq 97 aa AA seqDB search MSIRMSASLVIVLLALLTITEGMSLRGVGADLRCRCIETESRRIGRLIKKVEMFPPSSHC RDTEIIATLSNSGQEICLDVSAPWVKRVIKKMLANNK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgagcatcagaatgtcagccagccttgtcattgtgctcctggccctcctgaccattact gaggggatgagtctgagaggcgtgggggctgacctgcgatgtcgctgcattgagacggaa agcagacgaattggtagactcattaagaaggtggagatgttccctcccagctcgcactgc agagacactgagatcattgcaactctgagcaacagcggtcaggagatttgtctggatgtc agcgctccttgggtcaagagggtcattaagaagatgctggccaacaacaaatga

DBGET integrated database retrieval system