Sodalis glossinidius: SG1050 Help Entry SG1050            CDS       T00316                                  Name (GenBank) DNA-damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism sgl  Sodalis glossinidius Brite KEGG Orthology (KO) [BR:sgl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:sgl03400]     SG1050 DNA repair and recombination proteins [BR:sgl03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     SG1050 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI Motif Other DBs NCBI-ProteinID:  BAE74325 UniProt:  Q2NU50 LinkDB All DBs Position complement(1752008..1752238) Genome browser AA seq 76 aa AA seqDB search MRIEITLAKATPLPAGALEALSKELHLRIDKQFAEAKLQLRYASANGITVLGGNKGRQGA HHRHPARDVGKRRWLV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgcgcattgaaatcactctcgccaaagcgacaccgcttcctgctggtgccctggaggcg ttgagcaaagaattacaccttcgtatcgataaacaatttgcagaggccaagctgcagcta cgttatgccagcgccaatggcataacggtcctgggcggtaacaaagggagacaaggcgct catcaccgacatcctgcaagagacgtgggaaagcgccgatggttggtttga

DBGET integrated database retrieval system