Shewanella sp. MR-7: Shewmr7_1312 Help Entry Shewmr7_1312      CDS       T00389                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism shm  Shewanella sp. MR-7 Pathway shm00190   Oxidative phosphorylation shm01100   Metabolic pathways shm02020   Two-component system Module shm_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:shm00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Shewmr7_1312  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Shewmr7_1312 Enzymes [BR:shm01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      Shewmr7_1312 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  ABI42311 UniProt:  Q0HX44 LinkDB All DBs Position 1526078..1526194 Genome browser AA seq 38 aa AA seqDB search MWYFTWILGVLLACSFGVINALWLENTENMDRSSDDAE NT seq 117 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcacgtggatattaggggttttgttagcctgttcttttggtgtgatcaac gccctgtggcttgaaaacacggagaacatggaccgctcaagcgatgatgctgagtaa

DBGET integrated database retrieval system