Sturnira hondurensis: 118983245 Help Entry 118983245         CDS       T07222                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism shon  Sturnira hondurensis Pathway shon04146   Peroxisome shon04213   Longevity regulating pathway - multiple species shon05012   Parkinson disease shon05014   Amyotrophic lateral sclerosis shon05016   Huntington disease shon05020   Prion disease shon05022   Pathways of neurodegeneration - multiple diseases shon05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:shon00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     118983245 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     118983245 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     118983245 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     118983245 (SOD1)    05014 Amyotrophic lateral sclerosis     118983245 (SOD1)    05016 Huntington disease     118983245 (SOD1)    05020 Prion disease     118983245 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     118983245 (SOD1) Enzymes [BR:shon01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      118983245 (SOD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  118983245 NCBI-ProteinID:  XP_036896453 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MTTRAVCVLKGDGPVHGTIRFEQEGTGPVKVSGEIKGLTKGEHGFHVHEFGDNTQGCISA GPHFNPLHKTHGGPQDEERHVGDLGNVTAEENGVANVSLEDPLISLSGPHSIVGRTMVVH EKRDDLGRGGNDESKKTGNAGSRLACGVIGIAQ NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgacgaccagggctgtgtgcgtgctgaagggcgacggcccggtgcatggcaccatccgc ttcgagcaggagggcactggtcccgtcaaagtctccggggaaatcaaggggctgaccaaa ggcgagcatgggttccacgtccacgagtttggagacaacacccaaggctgcatcagtgcg ggtcctcactttaaccccctacacaaaacccacggcggaccccaggacgaagagaggcat gtcggggacctgggcaacgtgaccgcggaggaaaacggagtggccaacgtgtctctggaa gaccccctgatctccctctcggggccccattccattgttggccgcacgatggtggtccac gaaaagagggacgacttgggcagaggcgggaacgacgagagcaagaagacgggcaatgcc ggcagccgcctggcctgcggggtgatcgggattgcgcagtga

DBGET integrated database retrieval system