Sturnira hondurensis: 118983604 Help Entry 118983604         CDS       T07222                                  Name (RefSeq) cytochrome c   KO K08738   cytochrome c Organism shon  Sturnira hondurensis Pathway shon00190   Oxidative phosphorylation shon01100   Metabolic pathways shon01524   Platinum drug resistance shon04115   p53 signaling pathway shon04210   Apoptosis shon04215   Apoptosis - multiple species shon04932   Non-alcoholic fatty liver disease shon05010   Alzheimer disease shon05012   Parkinson disease shon05014   Amyotrophic lateral sclerosis shon05016   Huntington disease shon05017   Spinocerebellar ataxia shon05020   Prion disease shon05022   Pathways of neurodegeneration - multiple diseases shon05132   Salmonella infection shon05134   Legionellosis shon05145   Toxoplasmosis shon05152   Tuberculosis shon05160   Hepatitis C shon05161   Hepatitis B shon05162   Measles shon05163   Human cytomegalovirus infection shon05164   Influenza A shon05167   Kaposi sarcoma-associated herpesvirus infection shon05168   Herpes simplex virus 1 infection shon05169   Epstein-Barr virus infection shon05170   Human immunodeficiency virus 1 infection shon05200   Pathways in cancer shon05210   Colorectal cancer shon05222   Small cell lung cancer shon05416   Viral myocarditis shon05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:shon00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     118983604  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     118983604    04215 Apoptosis - multiple species     118983604    04115 p53 signaling pathway     118983604  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     118983604   09162 Cancer: specific types    05210 Colorectal cancer     118983604    05222 Small cell lung cancer     118983604   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     118983604    05161 Hepatitis B     118983604    05160 Hepatitis C     118983604    05164 Influenza A     118983604    05162 Measles     118983604    05168 Herpes simplex virus 1 infection     118983604    05163 Human cytomegalovirus infection     118983604    05167 Kaposi sarcoma-associated herpesvirus infection     118983604    05169 Epstein-Barr virus infection     118983604   09171 Infectious disease: bacterial    05132 Salmonella infection     118983604    05134 Legionellosis     118983604    05152 Tuberculosis     118983604   09174 Infectious disease: parasitic    05145 Toxoplasmosis     118983604   09164 Neurodegenerative disease    05010 Alzheimer disease     118983604    05012 Parkinson disease     118983604    05014 Amyotrophic lateral sclerosis     118983604    05016 Huntington disease     118983604    05017 Spinocerebellar ataxia     118983604    05020 Prion disease     118983604    05022 Pathways of neurodegeneration - multiple diseases     118983604   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     118983604    05416 Viral myocarditis     118983604   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     118983604   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     118983604 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  118983604 NCBI-ProteinID:  XP_036897172 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW GEATLMEYLENPKKYIPGTKMIFAGIKKSSERADLIAYLKKATNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaaaggcaagaagatttttgttcagaagtgtgcccagtgccatact gtggaaaagggaggcaagcacaagactgggccaaatctccatggtctgtttgggcgaaag acaggtcaggcccctggattttcttacacggatgccaacaagaacaaagggataacctgg ggagaggccacgctgatggagtatttggagaatcctaagaagtacatccctggaacaaaa atgatcttcgctggcattaagaagagttcagaaagggcagatttgatagcttatctgaaa aaagctactaatgagtaa

DBGET integrated database retrieval system