Sturnira hondurensis: 119001561 Help Entry 119001561         CDS       T07222                                  Name (RefSeq) C-C motif chemokine 4   KO K12964   C-C motif chemokine 4 Organism shon  Sturnira hondurensis Pathway shon04060   Cytokine-cytokine receptor interaction shon04061   Viral protein interaction with cytokine and cytokine receptor shon04062   Chemokine signaling pathway shon04064   NF-kappa B signaling pathway shon04620   Toll-like receptor signaling pathway shon04623   Cytosolic DNA-sensing pathway shon05163   Human cytomegalovirus infection Brite KEGG Orthology (KO) [BR:shon00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     119001561   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     119001561    04061 Viral protein interaction with cytokine and cytokine receptor     119001561  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     119001561    04623 Cytosolic DNA-sensing pathway     119001561    04062 Chemokine signaling pathway     119001561  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     119001561  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shon04052]     119001561 Cytokines and neuropeptides [BR:shon04052]  Cytokines   Chemokines    119001561 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Rubi_NSP_C Motif Other DBs NCBI-GeneID:  119001561 NCBI-ProteinID:  XP_036922857 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MKLCMTVLSLLVLGAAFCSPALSAPMGSDPPTACCFSYTTRQLPRDFVVDYYETSSLCSQ PAVVFQTKRGRQVCANPNEPWAQNYMNDLELSGAELS NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaagctctgcatgaccgtcctctcactcctggtgcttggggctgccttctgctccccc gcgctctcagcaccaatgggctcagacccgcccaccgcctgctgcttctcctacaccaca cggcaacttcctcgagacttcgtggtggattactatgagaccagcagcctgtgctcccag ccagcggtggtattccaaaccaagaggggcagacaagtctgtgccaaccccaatgagccc tgggcccagaactacatgaacgacctggagctgagcggagcggagctgagctga

DBGET integrated database retrieval system