Sturnira hondurensis: 119003497 Help Entry 119003497         CDS       T07222                                  Name (RefSeq) regakine-1-like   KO K12964   C-C motif chemokine 4 Organism shon  Sturnira hondurensis Pathway shon04060   Cytokine-cytokine receptor interaction shon04061   Viral protein interaction with cytokine and cytokine receptor shon04062   Chemokine signaling pathway shon04064   NF-kappa B signaling pathway shon04620   Toll-like receptor signaling pathway shon04623   Cytosolic DNA-sensing pathway shon05163   Human cytomegalovirus infection Brite KEGG Orthology (KO) [BR:shon00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     119003497   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     119003497    04061 Viral protein interaction with cytokine and cytokine receptor     119003497  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     119003497    04623 Cytosolic DNA-sensing pathway     119003497    04062 Chemokine signaling pathway     119003497  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     119003497  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shon04052]     119003497 Cytokines and neuropeptides [BR:shon04052]  Cytokines   Chemokines    119003497 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  119003497 NCBI-ProteinID:  XP_036925787 LinkDB All DBs Position Unknown AA seq 91 aa AA seqDB search MRASLVLLTFLLTVAALHSEANKEPAQDQVTPCCFSFSLRRIPFRFVKGYYWTTTQCPTP GVVFLTKHGKEICTNPSDDWVQQYIEQLDLQ NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgagggccagcctcgttctcctaaccttcctcctcactgtcgccgccctccactctgag gccaataaagaaccagctcaggaccaggttaccccctgctgtttctcgttcagccttcga agaatcccattccgctttgtgaaaggttattactggactacaacccagtgccccacccca ggggttgtcttcctcaccaaacatgggaaagagatttgtaccaaccccagtgatgactgg gtccagcagtacatagaacagctggatctccagtag

DBGET integrated database retrieval system