Sarcophilus harrisii (Tasmanian devil): 100916737 Help Entry 100916737         CDS       T02286                                  Name (RefSeq) C-C motif chemokine 4-like   KO K12964   C-C motif chemokine 4 Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04060   Cytokine-cytokine receptor interaction shr04061   Viral protein interaction with cytokine and cytokine receptor shr04062   Chemokine signaling pathway shr04064   NF-kappa B signaling pathway shr04620   Toll-like receptor signaling pathway shr04623   Cytosolic DNA-sensing pathway shr05163   Human cytomegalovirus infection Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     100916737   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100916737    04061 Viral protein interaction with cytokine and cytokine receptor     100916737  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100916737    04623 Cytosolic DNA-sensing pathway     100916737    04062 Chemokine signaling pathway     100916737  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     100916737  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shr04052]     100916737 Cytokines and neuropeptides [BR:shr04052]  Cytokines   Chemokines    100916737 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  100916737 NCBI-ProteinID:  XP_003770482 Ensembl:  ENSSHAG00000001832 UniProt:  G3VFV7 LinkDB All DBs Position 4:complement(428551637..428553648) Genome browser AA seq 91 aa AA seqDB search MKVSVAALSILMIMAFSSLASSAPMGSDPPISCCFSYVSQQIQRKFVTDYYETSSLCSQP AVVFLTKRGRQVCANPTDAWVQNYVEDLELN NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctctgtggctgctctctccatcctcatgatcatggccttcagctctctggca tcttctgcaccaatgggctctgaccctcccatctcctgctgcttctcctatgtcagccaa cagatccagagaaaatttgtgacagactattatgagaccagcagcctgtgttcccagcca gctgtggtgttcctgaccaaaaggggccggcaggtgtgcgccaatcccactgatgcctgg gtgcagaactatgtggaagacctggagctaaactga

DBGET integrated database retrieval system