Sarcophilus harrisii (Tasmanian devil): 100923817 Help Entry 100923817         CDS       T02286                                  Symbol CFL1 Name (RefSeq) cofilin-1   KO K05765   cofilin Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04360   Axon guidance shr04666   Fc gamma R-mediated phagocytosis shr04810   Regulation of actin cytoskeleton shr05133   Pertussis shr05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:shr00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100923817 (CFL1)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     100923817 (CFL1)   09158 Development and regeneration    04360 Axon guidance     100923817 (CFL1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100923817 (CFL1)   09171 Infectious disease: bacterial    05133 Pertussis     100923817 (CFL1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:shr04131]     100923817 (CFL1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:shr04812]     100923817 (CFL1)    04147 Exosome [BR:shr04147]     100923817 (CFL1) Membrane trafficking [BR:shr04131]  Others   Actin-binding proteins    Others     100923817 (CFL1) Cytoskeleton proteins [BR:shr04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      100923817 (CFL1) Exosome [BR:shr04147]  Exosomal proteins   Proteins found in most exosomes    100923817 (CFL1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cofilin_ADF Mt_ATP-synt_B Motif Other DBs NCBI-GeneID:  100923817 NCBI-ProteinID:  XP_023362475 Ensembl:  ENSSHAG00000002413 LinkDB All DBs Position 6:241465354..241467405 Genome browser AA seq 149 aa AA seqDB search MKVRKSSTPEEVKKRKKAVLFCLSEDKKNIVLEEGKEILVGDVGETVDDPYTTFVKMLPD KDCRYALYDATYETKESKKEDLVFIFWAPECAPLKSKMIYASSKDAIKKKLTGIKHELQA NCYEEVKDRCTLAEKLGGNAVISLEGKPL NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgaaagttcgcaagtcctccacacccgaggaggtgaagaagcgcaagaaggccgtgttg ttctgcctgagcgaggacaagaagaacattgtgctggaagagggcaaggagatcctcgtg ggtgacgtgggggagaccgtggacgacccctataccacctttgtcaagatgctcccagac aaggactgccgctatgccctctatgatgctacctacgagaccaaggagagcaagaaggag gacctcgtgttcatcttctgggcccccgagtgtgcccccctcaagagcaaaatgatctac gcgagctccaaggacgccatcaagaagaaactgacagggatcaaacacgaattacaagcc aactgttacgaggaagtgaaggaccgctgtaccctggccgagaaactggggggcaatgcc gtgatttccctggaggggaagcccttgtga

DBGET integrated database retrieval system