Sarcophilus harrisii (Tasmanian devil): 111721251 Help Entry 111721251         CDS       T02286                                  Name (RefSeq) cytochrome c   KO K08738   cytochrome c Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr00190   Oxidative phosphorylation shr01100   Metabolic pathways shr01524   Platinum drug resistance shr04115   p53 signaling pathway shr04210   Apoptosis shr04215   Apoptosis - multiple species shr04932   Non-alcoholic fatty liver disease shr05010   Alzheimer disease shr05012   Parkinson disease shr05014   Amyotrophic lateral sclerosis shr05016   Huntington disease shr05017   Spinocerebellar ataxia shr05020   Prion disease shr05022   Pathways of neurodegeneration - multiple diseases shr05132   Salmonella infection shr05134   Legionellosis shr05145   Toxoplasmosis shr05152   Tuberculosis shr05160   Hepatitis C shr05161   Hepatitis B shr05162   Measles shr05163   Human cytomegalovirus infection shr05164   Influenza A shr05167   Kaposi sarcoma-associated herpesvirus infection shr05168   Herpes simplex virus 1 infection shr05169   Epstein-Barr virus infection shr05170   Human immunodeficiency virus 1 infection shr05200   Pathways in cancer shr05210   Colorectal cancer shr05222   Small cell lung cancer shr05416   Viral myocarditis shr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:shr00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     111721251  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     111721251    04215 Apoptosis - multiple species     111721251    04115 p53 signaling pathway     111721251  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     111721251   09162 Cancer: specific types    05210 Colorectal cancer     111721251    05222 Small cell lung cancer     111721251   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     111721251    05161 Hepatitis B     111721251    05160 Hepatitis C     111721251    05164 Influenza A     111721251    05162 Measles     111721251    05168 Herpes simplex virus 1 infection     111721251    05163 Human cytomegalovirus infection     111721251    05167 Kaposi sarcoma-associated herpesvirus infection     111721251    05169 Epstein-Barr virus infection     111721251   09171 Infectious disease: bacterial    05132 Salmonella infection     111721251    05134 Legionellosis     111721251    05152 Tuberculosis     111721251   09174 Infectious disease: parasitic    05145 Toxoplasmosis     111721251   09164 Neurodegenerative disease    05010 Alzheimer disease     111721251    05012 Parkinson disease     111721251    05014 Amyotrophic lateral sclerosis     111721251    05016 Huntington disease     111721251    05017 Spinocerebellar ataxia     111721251    05020 Prion disease     111721251    05022 Pathways of neurodegeneration - multiple diseases     111721251   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     111721251    05416 Viral myocarditis     111721251   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     111721251   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     111721251 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  111721251 NCBI-ProteinID:  XP_031796426 LinkDB All DBs Position 5:273972240..273974277 Genome browser AA seq 105 aa AA seqDB search MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFTYTDANKNKGIIW GDDTLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKSTNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggggacgtggagaagggcaagaagatcttcgtgcagaagtgcgcccagtgccacacg gtggagaagggcggcaagcacaagaccgggcccaacctgcacgggctcttcggccgcaag accggccaggcccccggcttcacctacacagacgccaacaagaacaaaggcatcatctgg ggagacgacaccctgatggagtacctggaaaaccccaagaagtacatcccgggcacaaag atgatcttcgccggcatcaagaagaagggggagagggaagacttgatagcctacctcaag aagagcaccaatgagtaa

DBGET integrated database retrieval system