Serratia marcescens SM39: SM39_4832 Help Entry SM39_4832         CDS       T03592                                  Symbol holC Name (GenBank) DNA polymerase III, chi subunit   KO K02339   DNA polymerase III subunit chi [EC:2.7.7.7] Organism smar  Serratia marcescens SM39 Pathway smar03030   DNA replication smar03430   Mismatch repair smar03440   Homologous recombination Brite KEGG Orthology (KO) [BR:smar00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     SM39_4832 (holC)    03430 Mismatch repair     SM39_4832 (holC)    03440 Homologous recombination     SM39_4832 (holC)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:smar03032]     SM39_4832 (holC)    03400 DNA repair and recombination proteins [BR:smar03400]     SM39_4832 (holC) Enzymes [BR:smar01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      SM39_4832 (holC) DNA replication proteins [BR:smar03032]  Prokaryotic type   DNA Replication Elongation Factors    Elongation factors (bacterial)     DNA polymerase III holoenzyme      SM39_4832 (holC) DNA repair and recombination proteins [BR:smar03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA polymerase III holoenzyme      SM39_4832 (holC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol3_chi Motif Other DBs NCBI-ProteinID:  BAO36745 LinkDB All DBs Position complement(5043425..5043874) Genome browser AA seq 149 aa AA seqDB search MKQATFYLLDNAEPSGALSAHEAVACAVAANGFRSGKRVLIACESQEQAQRLDEALWQRE PHEFVPHNLAGEGPHYGAPVELCWPGKRGNAPRDLLIALLPQFADFATAFHEVVDFVPYE DTLKQLARDRYKAYRSVGFHLTTATPPTH NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgaaacaggcgacgttttatttgctcgacaacgcggaaccgtctggtgcgctcagcgcc catgaggccgtggcctgcgccgttgccgccaacggcttccgttccggcaagcgggtgctg atcgcctgcgagagccaggagcaggcccagcggctggacgaagcgctgtggcagcgcgag ccgcatgaattcgtgccgcacaacctggccggcgaagggccgcactacggcgcgccggtg gaactgtgctggcccggcaagcgcggcaacgccccgcgcgatctgctgatcgccctgctg ccgcagtttgccgattttgctaccgctttccatgaagtggtagacttcgttccttacgaa gacactctgaaacagttggcgcgcgaccgttacaaggcctatcgcagcgtcggcttccat ttgaccacggctacgccgccaactcactga

DBGET integrated database retrieval system