Saccharomyces paradoxus: SPAR_D05520 Help Entry SPAR_D05520       CDS       T08193                                  Name (RefSeq) Esc2   KO K10881   26 proteasome complex subunit DSS1 Organism spao  Saccharomyces paradoxus Pathway spao03050   Proteasome spao03440   Homologous recombination Brite KEGG Orthology (KO) [BR:spao00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     SPAR_D05520   09124 Replication and repair    03440 Homologous recombination     SPAR_D05520  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:spao03019]     SPAR_D05520    04131 Membrane trafficking [BR:spao04131]     SPAR_D05520    03051 Proteasome [BR:spao03051]     SPAR_D05520    03400 DNA repair and recombination proteins [BR:spao03400]     SPAR_D05520 Messenger RNA biogenesis [BR:spao03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      SPAR_D05520 Membrane trafficking [BR:spao04131]  Exocytosis   Tethering complex    Exocyst complex assembly proteins     SPAR_D05520 Proteasome [BR:spao03051]  Eukaryotic proteasome   Regulatory particles    PA700 (19S proteasome)     non-ATPase subunits      SPAR_D05520 DNA repair and recombination proteins [BR:spao03400]  Eukaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     Other HR factors      SPAR_D05520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DSS1_SEM1 Motif Other DBs NCBI-GeneID:  54629799 NCBI-ProteinID:  XP_033765585 UniProt:  A0A8B8UP77 LinkDB All DBs Position IV:1154714..1154983 Genome browser AA seq 89 aa AA seqDB search MSTDVAAAQAQSKIDSTKKKNEEINKKSLEEDDEFEDFPIDTWANGETIKSNSVTQTNIW EENWDDVEVDDDFTNELKAELDRYKRENQ NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagtactgacgttgctgctgcgcaagctcaaagtaaaatagattcaacaaaaaaaaag aatgaggaaataaataagaagtcgctggaggaagacgatgaatttgaagattttcctatt gacacatgggccaatggtgaaacaataaaaagcaatagtgtaacgcagacaaacatatgg gaagaaaactgggacgatgttgaagttgatgacgatttcaccaatgaattgaaggccgaa ctagatagatataaacgagaaaatcagtga

DBGET integrated database retrieval system