Solanum pennellii: 107021447 Help Entry 107021447         CDS       T04130                                  Name (RefSeq) RING-box protein 1-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism spen  Solanum pennellii Pathway spen03420   Nucleotide excision repair spen04120   Ubiquitin mediated proteolysis spen04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:spen00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107021447    04120 Ubiquitin mediated proteolysis     107021447   09124 Replication and repair    03420 Nucleotide excision repair     107021447  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:spen04121]     107021447    03400 DNA repair and recombination proteins [BR:spen03400]     107021447 Enzymes [BR:spen01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      107021447 Ubiquitin system [BR:spen04121]  Ubiquitin ligases (E3)   UBL E3 ligases    107021447   Multi subunit Ring-finger type E3    SCF complex     Ring finger protein      107021447    Cul2 complex      107021447    Cul3 complex      107021447    Cul4 complex      107021447    Cul7 complex      107021447    Cul8 complex      107021447    Cul9 complex      107021447 DNA repair and recombination proteins [BR:spen03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       107021447     TCR (transcription coupled repair) factors      Cul4-CSA complex       107021447 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 Motif Other DBs NCBI-GeneID:  107021447 NCBI-ProteinID:  XP_015077602 LinkDB All DBs Position 6:49985199..49988522 Genome browser AA seq 118 aa AA seqDB search MSTDVEMAAADEGSNVTAPPCCSSSSKKPKRFEIKKWNAVSLWAWDIVVDNCAICRNHIM DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgtctacagacgtcgagatggctgccgccgatgaaggatccaacgttaccgcacctcca tgctgttcttcttcttcgaagaaacccaagcgttttgagatcaaaaagtggaacgctgtc tctttatgggcttgggatattgttgtagacaactgtgctatttgcaggaaccatatcatg gatctctgcattgaatgtcaagctaatcaagctagtgctactagcgaggagtgcactgtt gcctggggtgtatgtaatcatgccttccactttcactgcatcagtcgatggctcaagacc cgtcaagtgtgcccactagataacagtgagtgggagtttcagaagtatggtcactag

DBGET integrated database retrieval system