Sphingorhabdus sp. M41: AZE99_05010 Help Entry AZE99_05010       CDS       T04317                                  Name (GenBank) DNA polymerase III subunit chi   KO K02339   DNA polymerase III subunit chi [EC:2.7.7.7] Organism sphg  Sphingorhabdus sp. M41 Pathway sphg03030   DNA replication sphg03430   Mismatch repair sphg03440   Homologous recombination Brite KEGG Orthology (KO) [BR:sphg00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     AZE99_05010    03430 Mismatch repair     AZE99_05010    03440 Homologous recombination     AZE99_05010  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sphg03032]     AZE99_05010    03400 DNA repair and recombination proteins [BR:sphg03400]     AZE99_05010 Enzymes [BR:sphg01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      AZE99_05010 DNA replication proteins [BR:sphg03032]  Prokaryotic type   DNA Replication Elongation Factors    Elongation factors (bacterial)     DNA polymerase III holoenzyme      AZE99_05010 DNA repair and recombination proteins [BR:sphg03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA polymerase III holoenzyme      AZE99_05010 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol3_chi Motif Other DBs NCBI-ProteinID:  AMO71304 UniProt:  A0A127MDH1 LinkDB All DBs Position 1035141..1035578 Genome browser AA seq 145 aa AA seqDB search MRVDFYHLTRDPAVKLVPMLASKSLDVGKRLLLLSQDEGRRSALSDALWSTDPASFLAHD LAGSEGQAEQPILISDQCEALNGAQYIILSDGSWREEALNFERAFFLFTADQIDHARTVW RDLANREAVTPRYWKQDGGRWVEGP NT seq 438 nt NT seq  +upstreamnt  +downstreamnt gtgcgggttgatttctatcatctgacccgcgatccggcggtcaagctggtgccgatgctg gccagcaaatcgctggatgttggaaaaaggctgttgctgctgtcgcaggacgaaggccgc cgttccgcgctcagcgatgctttgtggagcactgatccggccagctttctggctcatgat cttgctggatccgaggggcaggcggagcagccgatcctgatctccgatcagtgcgaggcg ctgaacggtgcgcaatatatcatcctgtccgatggctcgtggcgggaagaggcgctgaat ttcgagcgcgccttcttcctgtttaccgccgaccagatcgaccatgcgcgcactgtttgg cgggatttggctaaccgggaagctgtcaccccgcgctactggaagcaggatggcggtcgt tgggtagaaggcccctga

DBGET integrated database retrieval system