Serratia rhizosphaerae: FO014_10615 Help Entry FO014_10615       CDS       T07504                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism srhz  Serratia rhizosphaerae Brite KEGG Orthology (KO) [BR:srhz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:srhz03110]     FO014_10615 (grxC) Chaperones and folding catalysts [BR:srhz03110]  Protein folding catalysts   Protein disulfide isomerase    FO014_10615 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like Thioredoxin_3 SH3BGR DUF99 GldM_2nd GST_N Motif Other DBs NCBI-ProteinID:  QHA87363 UniProt:  A0A857EFD8 LinkDB All DBs Position 2259826..2260074 Genome browser AA seq 82 aa AA seqDB search MANIDIYTKATCPFCHRAKALLNSKGAAFNEIAIDGDNVKREEMIARSGRTTVPQIFIDG QHIGGCDDLYALDAQGGLDPLL NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggctaatatcgacatctacaccaaggcgacttgcccgttctgccatcgcgccaaggcg ctgctgaacagcaaaggcgccgcgttcaacgagatcgccatcgacggcgataacgtaaaa cgtgaagagatgattgcgcgcagtgggcgaaccaccgtgccgcaaattttcatcgacggc cagcatatcggcggctgcgatgatttatatgcacttgatgcgcaaggtggtctggatccg ctgctttaa

DBGET integrated database retrieval system